DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30156 and Dnajb1

DIOPT Version :9

Sequence 1:NP_001260752.1 Gene:CG30156 / 246488 FlyBaseID:FBgn0050156 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_001382078.1 Gene:Dnajb1 / 361384 RGDID:1304725 Length:340 Species:Rattus norvegicus


Alignment Length:106 Identity:37/106 - (34%)
Similarity:58/106 - (54%) Gaps:12/106 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 RNHYEVLRISHHATYSEVKRAYHKLALRLHPDKNKSPGAEQAFRRISEAADCLTDCQKRIEYNIA 159
            :::|:.|.::..|:..|:||||.:.|||.||||||.||||:.|:.|:||.|.|:|.:||   .|.
  Rat     3 KDYYQTLGLARGASDDEIKRAYRRQALRYHPDKNKEPGAEEKFKEIAEAYDVLSDPRKR---EIF 64

  Fly   160 TAVGDCHDQDPSQYKDYRGESEFNEANGNDLGAAFRRPYRG 200
            ...|:         :..:|......::|...|.:|...:.|
  Rat    65 DRYGE---------EGLKGGGPSGGSSGGANGTSFSYTFHG 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30156NP_001260752.1 DnaJ 96..157 CDD:278647 30/60 (50%)
DUF1977 237..334 CDD:286411
Dnajb1NP_001382078.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166347664
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.