DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30156 and Dnajb1

DIOPT Version :10

Sequence 1:NP_724520.1 Gene:CG30156 / 246488 FlyBaseID:FBgn0050156 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_001382078.1 Gene:Dnajb1 / 361384 RGDID:1304725 Length:340 Species:Rattus norvegicus


Alignment Length:106 Identity:37/106 - (34%)
Similarity:58/106 - (54%) Gaps:12/106 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 RNHYEVLRISHHATYSEVKRAYHKLALRLHPDKNKSPGAEQAFRRISEAADCLTDCQKRIEYNIA 159
            :::|:.|.::..|:..|:||||.:.|||.||||||.||||:.|:.|:||.|.|:|.:||   .|.
  Rat     3 KDYYQTLGLARGASDDEIKRAYRRQALRYHPDKNKEPGAEEKFKEIAEAYDVLSDPRKR---EIF 64

  Fly   160 TAVGDCHDQDPSQYKDYRGESEFNEANGNDLGAAFRRPYRG 200
            ...|:         :..:|......::|...|.:|...:.|
  Rat    65 DRYGE---------EGLKGGGPSGGSSGGANGTSFSYTFHG 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30156NP_724520.1 PRK14296 95..>227 CDD:237666 37/106 (35%)
DnaJ 96..157 CDD:395170 30/60 (50%)
DUF1977 238..334 CDD:462754
Dnajb1NP_001382078.1 DnaJ_bact 4..336 CDD:274090 37/105 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.