DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30156 and DNAJB1

DIOPT Version :9

Sequence 1:NP_001260752.1 Gene:CG30156 / 246488 FlyBaseID:FBgn0050156 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_006136.1 Gene:DNAJB1 / 3337 HGNCID:5270 Length:340 Species:Homo sapiens


Alignment Length:260 Identity:63/260 - (24%)
Similarity:98/260 - (37%) Gaps:92/260 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 RNHYEVLRISHHATYSEVKRAYHKLALRLHPDKNKSPGAEQAFRRISEAADCLTDCQKR------ 153
            :::|:.|.::..|:..|:||||.:.|||.||||||.||||:.|:.|:||.|.|:|.:||      
Human     3 KDYYQTLGLARGASDEEIKRAYRRQALRYHPDKNKEPGAEEKFKEIAEAYDVLSDPRKREIFDRY 67

  Fly   154 ----------------------IEYNIATAVGDCHDQDPSQYKDYRG-----ESEFNEANGNDLG 191
                                  ..|   |..||.|    :.:.::.|     ::.|.:.||.: |
Human    68 GEEGLKGSGPSGGSGGGANGTSFSY---TFHGDPH----AMFAEFFGGRNPFDTFFGQRNGEE-G 124

  Fly   192 AAFRRPYRGANQRMPQRQSLYQTQQLVIGVVAALVFLFVTMHFIAGAPAYSFTLTRTHSARRLSR 256
            .....|:.|....|..                     |..::|           .|:.||:..:|
Human   125 MDIDDPFSGFPMGMGG---------------------FTNVNF-----------GRSRSAQEPAR 157

  Fly   257 TNHIAYYMNPTTLSKYTEQQLAELEVEIEEVYIS-DLKHKCRQERSWRDNLFLRARQGNNDQKLL 320
                         .|.......:|.|.:||:|.. ..|.|...:|...|...:|     |:.|:|
Human   158 -------------KKQDPPVTHDLRVSLEEIYSGCTKKMKISHKRLNPDGKSIR-----NEDKIL 204

  Fly   321  320
            Human   205  204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30156NP_001260752.1 DnaJ 96..157 CDD:278647 30/88 (34%)
DUF1977 237..334 CDD:286411 18/85 (21%)
DNAJB1NP_006136.1 DnaJ 1..340 CDD:223560 63/260 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154067
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.