DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30156 and CG5001

DIOPT Version :10

Sequence 1:NP_724520.1 Gene:CG30156 / 246488 FlyBaseID:FBgn0050156 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_608586.2 Gene:CG5001 / 33308 FlyBaseID:FBgn0031322 Length:350 Species:Drosophila melanogaster


Alignment Length:106 Identity:36/106 - (33%)
Similarity:54/106 - (50%) Gaps:15/106 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 RNHYEVLRISHHATYSEVKRAYHKLALRLHPDKNKSPGAEQAFRRISEAADCLTDCQKRIEYNIA 159
            :::|::|.:...||..|:|:||.|||||.||||||:..||..|:.::||.:.|:|..||..|   
  Fly     3 KDYYKILGLPKTATDDEIKKAYRKLALRYHPDKNKAANAEDKFKEVAEAYEVLSDKSKREVY--- 64

  Fly   160 TAVGDCHDQDPSQYKDYRGESEFNEANGNDLGAAFRRPYRG 200
                |.:.:|        |.......||.....:|...:.|
  Fly    65 ----DKYGED--------GLKSGGTRNGGPSSNSFTYQFHG 93

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30156NP_724520.1 PRK14296 95..>227 CDD:237666 36/106 (34%)
DnaJ 96..157 CDD:395170 28/60 (47%)
DUF1977 238..334 CDD:462754
CG5001NP_608586.2 DnaJ_bact 4..347 CDD:274090 36/105 (34%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.