DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30156 and CG32641

DIOPT Version :9

Sequence 1:NP_001260752.1 Gene:CG30156 / 246488 FlyBaseID:FBgn0050156 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_727675.1 Gene:CG32641 / 318136 FlyBaseID:FBgn0052641 Length:132 Species:Drosophila melanogaster


Alignment Length:143 Identity:42/143 - (29%)
Similarity:66/143 - (46%) Gaps:18/143 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 NHYEVLRISHHATYSEVKRAYHKLALRLHPDKNKSPGAEQAFRRISEAADCLTDCQKRIEYNIAT 160
            ::|.:|.:.|:||..|::|||.::||..||||||.|.....||:|:||.:.|:|...|.:|    
  Fly     4 DYYMILGVDHNATDEEIRRAYKRMALIYHPDKNKHPRTTAQFRKINEAFNVLSDASARRKY---- 64

  Fly   161 AVGDCHDQDPSQYKDYRGESEFNEANGNDLGAAFRRPYRGANQRMPQRQSLYQTQQLVIGVVAAL 225
                    |.|.....|..:..|..|....     :| .|:.:|..:....:.|...|.||:..|
  Fly    65 --------DASVMLSRRAHTTNNSHNSGGY-----QP-NGSYEREMKTSDTFSTVCAVGGVLVGL 115

  Fly   226 VFLFVTMHFIAGA 238
            ...|.....::|:
  Fly   116 FLGFGAFKALSGS 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30156NP_001260752.1 DnaJ 96..157 CDD:278647 26/60 (43%)
DUF1977 237..334 CDD:286411 1/2 (50%)
CG32641NP_727675.1 DnaJ 4..65 CDD:278647 27/72 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458980
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.