DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30156 and Dnaja4

DIOPT Version :9

Sequence 1:NP_001260752.1 Gene:CG30156 / 246488 FlyBaseID:FBgn0050156 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_001020582.1 Gene:Dnaja4 / 300721 RGDID:1310035 Length:555 Species:Rattus norvegicus


Alignment Length:160 Identity:47/160 - (29%)
Similarity:76/160 - (47%) Gaps:26/160 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 KSDALPHKFTLEMLDVVQKVLRCRNHYEVLRISHHATYSEVKRAYHKLALRLHPDKNKSPGAEQA 136
            :||..|.:.|.|  :...|:::...:|::|.:...|:..|:|:||.||||:.|||||...|  :.
  Rat   142 ESDGQPEEQTSE--ENGDKMVKETQYYDILGVKPSASPEEIKKAYRKLALKYHPDKNPDEG--EK 202

  Fly   137 FRRISEAADCLTDCQKRIEYNIATAVGDCHDQDPSQYKDYRGESEFNEANGNDL-------GAAF 194
            |:.||:|.:.|:|.:||          |.:||...|.....|....:.::..|:       |...
  Rat   203 FKLISQAYEVLSDPKKR----------DIYDQGGEQAIKEGGSGSPSFSSPMDIFDMFFGGGGRM 257

  Fly   195 RRPYRGAN---QRMPQRQSLYQ--TQQLVI 219
            .|..||.|   |.....:.||.  |::|.:
  Rat   258 TRERRGKNVVHQLSVTLEDLYNGITKKLAL 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30156NP_001260752.1 DnaJ 96..157 CDD:278647 25/60 (42%)
DUF1977 237..334 CDD:286411
Dnaja4NP_001020582.1 PTZ00037 144..552 CDD:240236 46/158 (29%)
DnaJ 165..223 CDD:278647 26/69 (38%)
DnaJ_C 264..490 CDD:199909 6/24 (25%)
DnaJ_zf 293..359 CDD:199908
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.