DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30156 and Dnajb4

DIOPT Version :9

Sequence 1:NP_001260752.1 Gene:CG30156 / 246488 FlyBaseID:FBgn0050156 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_001013094.1 Gene:Dnajb4 / 295549 RGDID:1305826 Length:337 Species:Rattus norvegicus


Alignment Length:245 Identity:66/245 - (26%)
Similarity:96/245 - (39%) Gaps:66/245 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 RNHYEVLRISHHATYSEVKRAYHKLALRLHPDKNKSPGAEQAFRRISEAADCLTDCQKRIEYNIA 159
            :::|.:|.|...||..::|:||.|.||:.||||||||.||:.|:.::||.:.|:|.:||      
  Rat     3 KDYYHILGIEKGATDEDIKKAYRKQALKFHPDKNKSPQAEEKFKEVAEAYEVLSDPKKR------ 61

  Fly   160 TAVGDCHDQDPSQYKDYRGESEFNEANGND-LGAAFRRPYRGANQRMPQRQSLYQTQQLVIGVVA 223
                :.:||       :..|.....|.|.| .|..||..:.|...                ...|
  Rat    62 ----EIYDQ-------FGEEGLKGGAGGTDGQGGTFRYTFHGDPH----------------ATFA 99

  Fly   224 ALVFLFVTMHFIAGAPAYSFTLTRTHSARRLSRTNHI--------AYYMN----------PTTLS 270
            |         |..||..:.....|.....|.|....|        .:.||          |:.| 
  Rat   100 A---------FFGGANPFEIFFGRRMGGGRDSEEMEIDGDPFSAFGFSMNGYPRDRNSVGPSRL- 154

  Fly   271 KYTEQQLAELEVEIEEVYISDLKHKCRQERSWRDNLFLRARQGNNDQKLL 320
            |.....:.||:|.:||:|....|   |.:.| |..|....|...::.|:|
  Rat   155 KQDPPIIHELKVSLEEIYSGCTK---RMKIS-RKRLNPDGRSYRSEDKIL 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30156NP_001260752.1 DnaJ 96..157 CDD:278647 28/60 (47%)
DUF1977 237..334 CDD:286411 25/102 (25%)
Dnajb4NP_001013094.1 DnaJ 1..332 CDD:223560 66/245 (27%)
DnaJ 4..65 CDD:278647 28/70 (40%)
DnaJ_C 158..320 CDD:199909 14/47 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.