DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30156 and Dnajc18

DIOPT Version :9

Sequence 1:NP_001260752.1 Gene:CG30156 / 246488 FlyBaseID:FBgn0050156 Length:358 Species:Drosophila melanogaster
Sequence 2:XP_006254608.1 Gene:Dnajc18 / 291677 RGDID:1310237 Length:357 Species:Rattus norvegicus


Alignment Length:305 Identity:87/305 - (28%)
Similarity:140/305 - (45%) Gaps:48/305 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 TRKSDALPHKFTLEMLDVVQKVLRCRNHYEVLRISHHATYSEVKRAYHKLALRLHPDKNKSPGAE 134
            ||:.|. ...:|.|.|..||::.:|||:|::|.:||:|:..|:|:||.||||:.|||||.:|||.
  Rat    57 TRQGDG-NATYTEEQLRGVQRIKKCRNYYDILGVSHNASDEELKKAYKKLALKFHPDKNCAPGAT 120

  Fly   135 QAFRRISEAADCLTDCQKRIEYNIATAVGDCHDQ--------DPSQY-----KDYRGESEFNE-- 184
            .||:.|..|...|::..||:.|:   ..||  :|        .|..|     .|...|..||.  
  Rat   121 DAFKAIGNAFAVLSNPDKRLRYD---EYGD--EQVTLTAPRARPYHYYRDVEADISPEELFNVFF 180

  Fly   185 ------------ANGNDLGAAFRRPYRGANQRMPQR-----QSLYQTQQLVIGVVAALVFLFVTM 232
                        :|..|....:||.:|....:..:|     |:.|.....::.|: .:|.:.|..
  Rat   181 GGHFPSGNIHMFSNVTDDSHYYRRRHRHERTQAHKREEDKSQTPYSAFVQLLPVL-LIVTISVIT 244

  Fly   233 HFIAGAPAYS--FTLTRTHSARRLSRTNHIAYYMNPTTLSKYTEQQLAELEVEIEEVYISDLKHK 295
            ..:|..|.||  :..|..::..|.::...:.|:::......|....|.:||..||:.||..::..
  Rat   245 QLLAANPPYSLFYKSTLGYTISRETQNLQVPYFVDKNFDKAYRGASLRDLEKTIEKDYIDYIQTS 309

  Fly   296 C---RQERSWRDNLFLRARQGNNDQKLLQHVSQMSTPACQALLQL 337
            |   :|::|...||....|    |::|.|....:....|..|.:|
  Rat   310 CWKEKQQKSELTNLAGLYR----DERLRQKAESLKLENCAKLSKL 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30156NP_001260752.1 DnaJ 96..157 CDD:278647 29/60 (48%)
DUF1977 237..334 CDD:286411 24/101 (24%)
Dnajc18XP_006254608.1 DnaJ 82..143 CDD:278647 29/60 (48%)
DUF1977 250..349 CDD:286411 25/102 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1173544at2759
OrthoFinder 1 1.000 - - FOG0001005
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR43908
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.880

Return to query results.
Submit another query.