DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30156 and SPOM_SPAC4G9.19

DIOPT Version :10

Sequence 1:NP_724520.1 Gene:CG30156 / 246488 FlyBaseID:FBgn0050156 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_593700.1 Gene:SPOM_SPAC4G9.19 / 2543511 PomBaseID:SPAC4G9.19 Length:270 Species:Schizosaccharomyces pombe


Alignment Length:80 Identity:23/80 - (28%)
Similarity:38/80 - (47%) Gaps:14/80 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 LRCRNHYEVLRISHHATYSEVKRAYHKLALRLHPDKNKSPGA--------------EQAFRRISE 142
            |:....||:|.:....|.:::||.|.:|..:.||||.|:...              |:.||.:..
pombe    28 LKSLTPYEILELPRTCTANDIKRKYIELVKKHHPDKMKNASQLAPTESPPEINKHNEEYFRLLLA 92

  Fly   143 AADCLTDCQKRIEYN 157
            |...|:|.::|.||:
pombe    93 ANALLSDKRRREEYD 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30156NP_724520.1 PRK14296 95..>227 CDD:237666 22/77 (29%)
DnaJ 96..157 CDD:395170 21/74 (28%)
DUF1977 238..334 CDD:462754
SPOM_SPAC4G9.19NP_593700.1 DnaJ_bact 34..>110 CDD:274090 22/74 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.