DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30156 and Dnajb9

DIOPT Version :9

Sequence 1:NP_001260752.1 Gene:CG30156 / 246488 FlyBaseID:FBgn0050156 Length:358 Species:Drosophila melanogaster
Sequence 2:XP_038967719.1 Gene:Dnajb9 / 24908 RGDID:3070 Length:234 Species:Rattus norvegicus


Alignment Length:154 Identity:46/154 - (29%)
Similarity:76/154 - (49%) Gaps:35/154 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 FTLEMLDVVQKVLRCRNHYEVLRISHHATYSEVKRAYHKLALRLHPDKNKSPGAEQAFRRISEAA 144
            |.:.:|.:.:.:|..:|:|::|.:...|:..::|:|:||||::.||||||||.||..||.|:||.
  Rat    22 FAICILMITELILASKNYYDILGVPKSASERQIKKAFHKLAMKYHPDKNKSPDAEAKFREIAEAY 86

  Fly   145 DCLTDCQKRIEYNIATAVGDCHDQDPSQYKDYRGESEFNEANG-NDLGAAFRRPYR--------- 199
            :.|:|..:|.||:|.                  |.|.|....| ...|:.|.:.:.         
  Rat    87 ETLSDANRRKEYDII------------------GHSAFTNGKGQRSNGSPFEQSFNFNFDDLFKD 133

  Fly   200 ----GANQRMPQR---QSLYQTQQ 216
                |.||....:   ::.:||:|
  Rat   134 FNLFGQNQNTRSKKHFENHFQTRQ 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30156NP_001260752.1 DnaJ 96..157 CDD:278647 29/60 (48%)
DUF1977 237..334 CDD:286411
Dnajb9XP_038967719.1 DnaJ 35..>147 CDD:223560 40/129 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1173544at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.