DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30156 and Dnajb6

DIOPT Version :9

Sequence 1:NP_001260752.1 Gene:CG30156 / 246488 FlyBaseID:FBgn0050156 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_001365764.1 Gene:Dnajb6 / 23950 MGIID:1344381 Length:372 Species:Mus musculus


Alignment Length:140 Identity:41/140 - (29%)
Similarity:64/140 - (45%) Gaps:37/140 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 NHYEVLRISHHATYSEVKRAYHKLALRLHPDKN--KSPGAEQAFRRISEAADCLTDCQKRIEY-- 156
            ::||||.:..||:..::|:||.|.||:.|||||  ....||:.|::::||.:.|:|.:||..|  
Mouse     3 DYYEVLGVQRHASPEDIKKAYRKQALKWHPDKNPENKEEAERKFKQVAEAYEVLSDAKKRDIYDK 67

  Fly   157 ------NIATAVGDCHDQDPSQ-----------YKDYRG----------ESEFNEANGNDLGAAF 194
                  |.....|..|...|.:           ::::.|          |..|::..||      
Mouse    68 YGKEGLNGGGGGGGIHFDSPFEFGFTFRNPDDVFREFFGGRDPFSFDFFEDPFDDFFGN------ 126

  Fly   195 RRPYRGANQR 204
            ||..||...|
Mouse   127 RRGPRGNRSR 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30156NP_001260752.1 DnaJ 96..157 CDD:278647 27/70 (39%)
DUF1977 237..334 CDD:286411
Dnajb6NP_001365764.1 Interaction with HSP70. /evidence=ECO:0000250 1..147 41/140 (29%)
DnaJ 2..>138 CDD:223560 41/140 (29%)
Interaction with KRT18. /evidence=ECO:0000250 120..235 8/23 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844313
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.