DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30156 and Dnajc16

DIOPT Version :9

Sequence 1:NP_001260752.1 Gene:CG30156 / 246488 FlyBaseID:FBgn0050156 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_758841.1 Gene:Dnajc16 / 214063 MGIID:2442146 Length:772 Species:Mus musculus


Alignment Length:272 Identity:61/272 - (22%)
Similarity:104/272 - (38%) Gaps:75/272 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 YEVLRISHHATYSEVKRAYHKLALRLHPDKNKSPGAEQAFRRISEAADCLTDCQKRIEYNIATAV 162
            |.||.:|..|:.:::|:||.|||...||||||.||||..|.:||:|.:.|::.:||..|      
Mouse    31 YRVLGVSRTASQADIKKAYKKLAREWHPDKNKDPGAEDRFIQISKAYEILSNEEKRTNY------ 89

  Fly   163 GDCHDQDPSQYKDYRGESEFNEANGNDLGAAFRRPYRGANQRMPQRQSLYQTQQLVIGVVAALVF 227
                        |:.|::                   |.||...::|..::             |
Mouse    90 ------------DHYGDA-------------------GENQGYQKQQREHR-------------F 110

  Fly   228 LFVTMHFIAGAPAYSFTLTRTHSARRLSRTN----HIAYYMNPTTLSKYTEQQLAELEVEIEEVY 288
            .....:|......:.|..   ::.||.|...    |.::|:|......:....|.::        
Mouse   111 RHFHENFYFDESFFHFPF---NAERRDSGDEKYLLHFSHYVNEVLPESFKRPYLIKI-------- 164

  Fly   289 ISDLKHKC-RQERSWRD--------NLFLRARQGNNDQKLLQHVSQMSTPACQALLQLGKSGHSR 344
            .||....| ..|..|::        .:.:.......:::|..|:...|||:...::. ||.....
Mouse   165 TSDWCFSCIHIEPVWKEVVQELEGLGVGIGVVHAGYERRLAHHLGAHSTPSILGVIS-GKITFFH 228

  Fly   345 LLLENESLNQDV 356
            ..:.:|:|.|.|
Mouse   229 NAVVHENLRQFV 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30156NP_001260752.1 DnaJ 96..157 CDD:278647 28/58 (48%)
DUF1977 237..334 CDD:286411 18/109 (17%)
Dnajc16NP_758841.1 DnaJ 29..>135 CDD:223560 40/156 (26%)
TRX_DnaJ 134..243 CDD:239261 21/116 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 560..591
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.