powered by:
Protein Alignment CG30156 and dnj-17
DIOPT Version :9
Sequence 1: | NP_001260752.1 |
Gene: | CG30156 / 246488 |
FlyBaseID: | FBgn0050156 |
Length: | 358 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_499759.2 |
Gene: | dnj-17 / 176761 |
WormBaseID: | WBGene00001035 |
Length: | 485 |
Species: | Caenorhabditis elegans |
Alignment Length: | 68 |
Identity: | 28/68 - (41%) |
Similarity: | 40/68 - (58%) |
Gaps: | 4/68 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 92 LRCRNHYEVLRISHHATYSEVKRAYHKLALRLHPDKNKSPGAE--QAFRRISEAADCLTDCQKRI 154
::| |||||.:...|...::|:.|.||||:.|||||.....| |.||.:..|.|.|:|.::|.
Worm 1 MKC--HYEVLEVERDADDDKIKKNYRKLALKWHPDKNPDRIEECTQQFRLLQAAYDVLSDPRERE 63
Fly 155 EYN 157
.|:
Worm 64 FYD 66
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.