DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30156 and dnj-24

DIOPT Version :9

Sequence 1:NP_001260752.1 Gene:CG30156 / 246488 FlyBaseID:FBgn0050156 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_498155.3 Gene:dnj-24 / 175745 WormBaseID:WBGene00001042 Length:249 Species:Caenorhabditis elegans


Alignment Length:179 Identity:47/179 - (26%)
Similarity:73/179 - (40%) Gaps:28/179 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 YEVLRISHHATYSEVKRAYHKLALRLHPDKN----KSPGAEQAFRRISEAADCLTDCQKRIEYNI 158
            |..|.||..:...|:|:||.||||:.||||:    ....|||.|::|::|.:.|||.:||.:.: 
 Worm     9 YITLGISSTSDDVEIKKAYRKLALKWHPDKHTDDKSKEEAEQKFKKIAQAYEILTDKKKRADLD- 72

  Fly   159 ATAVGDCHDQDPSQYKDYRGESEFNEANGNDLGAAFRRPY----RGANQRMPQRQSLYQTQQLVI 219
                   ..::|..::........:..:.:|:   ||.|:    .....|.|.....:..     
 Worm    73 -------RTENPGLHRRRSTPGGMHRMHSHDM---FRSPFDIFREFFGNRDPFENVFFDD----- 122

  Fly   220 GVVAALVFLFVTMHFIAGAPAYSFTLTRTHSARRLSRTNHIAYYMNPTT 268
                |..|..|..:.....|..:...|:.|..|..|...||.|..|..|
 Worm   123 ----AFTFPDVDSYAFKHPPRSADFTTKNHYHRFPSSRVHIFYDENKNT 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30156NP_001260752.1 DnaJ 96..157 CDD:278647 27/62 (44%)
DUF1977 237..334 CDD:286411 10/32 (31%)
dnj-24NP_498155.3 DnaJ 9..>111 CDD:223560 32/112 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.