DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30156 and dnj-27

DIOPT Version :9

Sequence 1:NP_001260752.1 Gene:CG30156 / 246488 FlyBaseID:FBgn0050156 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_001040704.1 Gene:dnj-27 / 173065 WormBaseID:WBGene00001045 Length:788 Species:Caenorhabditis elegans


Alignment Length:284 Identity:60/284 - (21%)
Similarity:107/284 - (37%) Gaps:91/284 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 NHYEVLRISHHATYSEVKRAYHKLALRLHPDKN-KSPGAEQAFRRISEAADCLTDCQKRIEYNIA 159
            ::||:|.:...|....:::|:.|||::.|||:| ..|.|...|.:|::|.:.|.|...|.:|:  
 Worm    20 DYYELLGVERDADDRTIRKAFKKLAIKKHPDRNTDDPNAHDEFVKINKAYEVLKDENLRKKYD-- 82

  Fly   160 TAVGDCHDQDPSQYKDYRGESEFNEANGNDLGAAFRRPYRGAN-----QRMPQRQSLYQTQQLVI 219
                                 :|.|....|       .::|.|     |.......:|...|.::
 Worm    83 ---------------------QFGEKGLED-------GFQGGNNYQSWQFYNDNFGIYDDDQEIV 119

  Fly   220 GVVAALVFLFVTMHFIAGAPAYSFTLTRTHSARRLSRTNHIAYYMNPTTLSKYTE--QQLA---- 278
                                    ||.|....|.:|.:|.| :::|  ..|.|..  .|||    
 Worm   120 ------------------------TLNRADFQRMVSDSNEI-WFIN--FYSTYCSHCHQLAPTWR 157

  Fly   279 ----ELE--VEIEEVYISDLKHKCRQER--SWRDNLFL---RARQGNNDQKLLQHVSQMSTPACQ 332
                |:|  :.:..|..::....|:.:|  ::...:|.   ...||:.|.:|:...:        
 Worm   158 KFAREIEGTIRVGAVNCAEDPQLCQSQRVNAYPSLVFYPTGEFYQGHRDVELMVDFA-------- 214

  Fly   333 ALLQLGKSGHSRLLLEN-ESLNQD 355
              :|..||....|..|| ::|::|
 Worm   215 --IQRLKSEVLHLNSENWKALSED 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30156NP_001260752.1 DnaJ 96..157 CDD:278647 20/61 (33%)
DUF1977 237..334 CDD:286411 23/113 (20%)
dnj-27NP_001040704.1 DnaJ 18..>150 CDD:223560 39/186 (21%)
DnaJ 20..82 CDD:278647 20/61 (33%)
PDI_a_ERdj5_N 116..214 CDD:239301 24/124 (19%)
Thioredoxin_like 222..>312 CDD:294274 5/15 (33%)
ER_PDI_fam 438..750 CDD:273457
PDI_a_ERdj5_C 438..543 CDD:239302
PDI_a_ERdj5_C 549..664 CDD:239302
PDI_a_ERdj5_C 670..773 CDD:239302
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.