DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30156 and dnj-4

DIOPT Version :9

Sequence 1:NP_001260752.1 Gene:CG30156 / 246488 FlyBaseID:FBgn0050156 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_491558.1 Gene:dnj-4 / 172173 WormBaseID:WBGene00001022 Length:274 Species:Caenorhabditis elegans


Alignment Length:270 Identity:57/270 - (21%)
Similarity:84/270 - (31%) Gaps:109/270 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 PHKFTLEMLDVVQKVLRCRNHYEVLRISHHATYSEVKRAYHKLALRLHPDKNKSPGAEQAFRRIS 141
            ||.|.:.......|.:|.|.|||||.:...||.||:|.|::..:.::|||.:....|..:|..:.
 Worm     9 PHGFWVCQARFFNKKIRQRTHYEVLGVESTATLSEIKSAFYAQSKKVHPDNSSEESATASFLELK 73

  Fly   142 EAADCLTDCQKRIEYNIATAVGDCHDQDPSQYKDYRGESEFNEANGNDLGAAFRRPYRGANQRMP 206
            .|.|.|.....|..|                  ||:                    .||...|.|
 Worm    74 NAYDVLRRPADRRLY------------------DYQ--------------------LRGGGGRYP 100

  Fly   207 QRQSLYQTQQLVIGVVAALVFLFVTMHFIAGAPAYSFTL------------------TRTHSARR 253
            .....||                    :...||.|.|:.                  .|..|:|.
 Worm   101 NGGQRYQ--------------------YPNTAPQYDFSRDWSTYWSQNPDNSRSSREERDKSSRE 145

  Fly   254 LSRT-------------NHIAYYMNPTTLSKYTEQQLAELEVEIEEVYISDLKHKCRQERSWRDN 305
            ..::             .:...|:   .|..|.::||.:|   |:|..|:    ||         
 Worm   146 FMKSIVKWTAIGLVLVAGYNGGYL---YLLAYNQKQLDKL---IDEDEIA----KC--------- 191

  Fly   306 LFLRARQGNN 315
             |||.::..|
 Worm   192 -FLRQKEFRN 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30156NP_001260752.1 DnaJ 96..157 CDD:278647 20/60 (33%)
DUF1977 237..334 CDD:286411 22/110 (20%)
dnj-4NP_491558.1 CbpA 27..>155 CDD:225124 37/185 (20%)
DnaJ 28..89 CDD:365959 21/78 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.