DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30156 and dnj-28

DIOPT Version :9

Sequence 1:NP_001260752.1 Gene:CG30156 / 246488 FlyBaseID:FBgn0050156 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_491084.1 Gene:dnj-28 / 171870 WormBaseID:WBGene00001046 Length:494 Species:Caenorhabditis elegans


Alignment Length:112 Identity:29/112 - (25%)
Similarity:53/112 - (47%) Gaps:19/112 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 RNHYEVLRISHHATYSEVKRAYHKLALRLHP----DKNKSPGAEQAFRRISEAADCLTDCQKRIE 155
            |::|::|.:..:|...|:.:||.|:|.:.||    |:.:...||:.|..|:.|.:.|::.:||..
 Worm   379 RDYYKILGVRRNANKREITKAYRKMAQKWHPDNFQDEKEKKKAEKKFIDIAAAKEVLSNEEKRRA 443

  Fly   156 YNIATAVGDCHDQDPSQYKDYRGESEFNEANGNDLGAAFRRPYRGAN 202
            ::        :.|||.       :||.....|...|:.....:.|.|
 Worm   444 FD--------NGQDPL-------DSEAGRGGGGGGGSHGFHNFHGFN 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30156NP_001260752.1 DnaJ 96..157 CDD:278647 19/64 (30%)
DUF1977 237..334 CDD:286411
dnj-28NP_491084.1 TPR_11 23..89 CDD:290150
TPR repeat 28..52 CDD:276809
TPR_1 <31..56 CDD:278916
TPR repeat 57..87 CDD:276809
TPR_9 78..136 CDD:290108
TPR repeat 92..116 CDD:276809
TPR_11 174..240 CDD:290150
TPR repeat 175..203 CDD:276809
TPR repeat 208..238 CDD:276809
TPR repeat 291..321 CDD:276809
TPR_11 294..356 CDD:290150
TPR repeat 326..352 CDD:276809
DnaJ 378..>445 CDD:223560 20/65 (31%)
DnaJ 380..445 CDD:278647 19/64 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.