DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30156 and DNAJB8

DIOPT Version :9

Sequence 1:NP_001260752.1 Gene:CG30156 / 246488 FlyBaseID:FBgn0050156 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_699161.1 Gene:DNAJB8 / 165721 HGNCID:23699 Length:232 Species:Homo sapiens


Alignment Length:251 Identity:60/251 - (23%)
Similarity:103/251 - (41%) Gaps:63/251 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 NHYEVLRISHHATYSEVKRAYHKLALRLHPDKN--KSPGAEQAFRRISEAADCLTDCQKRIEYNI 158
            |:||||.:...|:..::|:||.|||||.|||||  ....||:.|:.:|||.:.|:|.:||..|:.
Human     3 NYYEVLGVQASASPEDIKKAYRKLALRWHPDKNPDNKEEAEKKFKLVSEAYEVLSDSKKRSLYDR 67

  Fly   159 A-----TAVGDC----HD--------QDPSQ-YKDYRG----------ESEFNE---ANGNDLGA 192
            |     .|.|..    |.        ::|.. ::::.|          :|.||.   ..|:.|..
Human    68 AGCDSWRAGGGASTPYHSPFDTGYTFRNPEDIFREFFGGLDPFSFEFWDSPFNSDRGGRGHGLRG 132

  Fly   193 AFRRPYRGANQRMPQRQSLYQTQQLVIGVVAALVFLFVTMHFIAGAPAYSFTLTRTHSARRLSRT 257
            ||...:                     |...|.:..|.:.:.:..:.....|.:.|......|.:
Human   133 AFSAGF---------------------GEFPAFMEAFSSFNMLGCSGGSHTTFSSTSFGGSSSGS 176

  Fly   258 NHIAYYMNPTTL---SKYTEQQLAE-----LEVEIEEVYISDLKHKCRQERSWRDN 305
            :.....|:.|.:   .|.|.:::.|     :||| |:..:..:....:::..|.|:
Human   177 SGFKSVMSSTEMINGHKVTTKRIVENGQERVEVE-EDGQLKSVTVNGKEQLKWMDS 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30156NP_001260752.1 DnaJ 96..157 CDD:278647 29/62 (47%)
DUF1977 237..334 CDD:286411 14/77 (18%)
DNAJB8NP_699161.1 DnaJ 3..>106 CDD:223560 35/102 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154062
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.