Sequence 1: | NP_001260752.1 | Gene: | CG30156 / 246488 | FlyBaseID: | FBgn0050156 | Length: | 358 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_699161.1 | Gene: | DNAJB8 / 165721 | HGNCID: | 23699 | Length: | 232 | Species: | Homo sapiens |
Alignment Length: | 251 | Identity: | 60/251 - (23%) |
---|---|---|---|
Similarity: | 103/251 - (41%) | Gaps: | 63/251 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 96 NHYEVLRISHHATYSEVKRAYHKLALRLHPDKN--KSPGAEQAFRRISEAADCLTDCQKRIEYNI 158
Fly 159 A-----TAVGDC----HD--------QDPSQ-YKDYRG----------ESEFNE---ANGNDLGA 192
Fly 193 AFRRPYRGANQRMPQRQSLYQTQQLVIGVVAALVFLFVTMHFIAGAPAYSFTLTRTHSARRLSRT 257
Fly 258 NHIAYYMNPTTL---SKYTEQQLAE-----LEVEIEEVYISDLKHKCRQERSWRDN 305 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG30156 | NP_001260752.1 | DnaJ | 96..157 | CDD:278647 | 29/62 (47%) |
DUF1977 | 237..334 | CDD:286411 | 14/77 (18%) | ||
DNAJB8 | NP_699161.1 | DnaJ | 3..>106 | CDD:223560 | 35/102 (34%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165154062 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0714 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.740 |