DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30156 and LOC1275333

DIOPT Version :10

Sequence 1:NP_724520.1 Gene:CG30156 / 246488 FlyBaseID:FBgn0050156 Length:358 Species:Drosophila melanogaster
Sequence 2:XP_314571.4 Gene:LOC1275333 / 1275333 VectorBaseID:AGAMI1_001486 Length:153 Species:Anopheles gambiae


Alignment Length:67 Identity:30/67 - (44%)
Similarity:39/67 - (58%) Gaps:7/67 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 YEVLRISHHATYSEVKRAYHKLALRLHPDKNKSP-----GAEQA--FRRISEAADCLTDCQKRIE 155
            |:||.:|..||..|::|:|..||||.||||.|:.     |.|:|  |.||.||...|.|.:.|..
Mosquito    15 YDVLEVSRTATLEEIRRSYQTLALRYHPDKRKASEREAGGDERADQFIRIDEAWKTLRDERLRRI 79

  Fly   156 YN 157
            |:
Mosquito    80 YD 81

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30156NP_724520.1 PRK14296 95..>227 CDD:237666 30/67 (45%)
DnaJ 96..157 CDD:395170 29/65 (45%)
DUF1977 238..334 CDD:462754
LOC1275333XP_314571.4 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.