DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30156 and zgc:152986

DIOPT Version :9

Sequence 1:NP_001260752.1 Gene:CG30156 / 246488 FlyBaseID:FBgn0050156 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_001275586.1 Gene:zgc:152986 / 101884054 ZFINID:ZDB-GENE-061013-762 Length:177 Species:Danio rerio


Alignment Length:95 Identity:33/95 - (34%)
Similarity:57/95 - (60%) Gaps:5/95 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 NHYEVLRISHHATYSEVKRAYHKLALRLHPDKNKSPGAEQAFRRISEAADCLTDCQKRIEYNIAT 160
            ::|.||.:|...:..::|:|:|||||:.|||||::|.|:|.|..|::|.:.|:|.:||..|:...
Zfish    22 DYYSVLGVSRFVSSRDIKKAFHKLALKHHPDKNQTPNAQQTFTHIAQAYEVLSDREKRRVYDQMD 86

  Fly   161 AVGDCHDQDPSQYKDYRGESEFNEANGNDL 190
                 |..:|.|..:...:.:..|..|::|
Zfish    87 -----HLSNPDQGSERMVKKDQTEDMGSNL 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30156NP_001260752.1 DnaJ 96..157 CDD:278647 26/60 (43%)
DUF1977 237..334 CDD:286411
zgc:152986NP_001275586.1 DnaJ 22..83 CDD:278647 26/60 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1173544at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.