DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30156 and dnajb9

DIOPT Version :9

Sequence 1:NP_001260752.1 Gene:CG30156 / 246488 FlyBaseID:FBgn0050156 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_001116196.1 Gene:dnajb9 / 100038131 XenbaseID:XB-GENE-493656 Length:221 Species:Xenopus tropicalis


Alignment Length:111 Identity:38/111 - (34%)
Similarity:66/111 - (59%) Gaps:6/111 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 FTLEMLDVVQKVLRCRNHYEVLRISHHATYSEVKRAYHKLALRLHPDKNKSPGAEQAFRRISEAA 144
            |.:.:|.:.:.:|..:.:|::|.:..:|:..::|:|:||||::.||||||||.||..||.|:||.
 Frog    10 FAVCILLISEIILAKKTYYDILGVPKNASERQIKKAFHKLAMKYHPDKNKSPDAEAKFREIAEAY 74

  Fly   145 DCLTDCQKRIEYN------IATAVGDCHDQDPSQYKDYRGESEFNE 184
            :.|:|..||.||:      .|.|.....||...::.::..:..|.:
 Frog    75 ETLSDESKRKEYDQFGHDAFANAGKGSSDQHFHKHFNFNFDDLFKD 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30156NP_001260752.1 DnaJ 96..157 CDD:278647 29/60 (48%)
DUF1977 237..334 CDD:286411
dnajb9NP_001116196.1 DnaJ 23..>193 CDD:223560 35/98 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1173544at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.