DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30156 and dnajb12b

DIOPT Version :9

Sequence 1:NP_001260752.1 Gene:CG30156 / 246488 FlyBaseID:FBgn0050156 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_001082977.1 Gene:dnajb12b / 100037354 ZFINID:ZDB-GENE-070410-128 Length:159 Species:Danio rerio


Alignment Length:170 Identity:44/170 - (25%)
Similarity:68/170 - (40%) Gaps:51/170 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGILQARRHHCVDKVVSDLCLGHYE---------------HALRQINEDL--------------- 35
            |.:.:.....|:|..|..|....:|               |..|.:.|.|               
Zfish     1 MEVNRDEAERCIDIAVEALEDSQHEKARRFLEKAQRLFPTHRARDLLESLERNGNPSWSQSSAGG 65

  Fly    36 --EGLQNHDEIMALLELKNIILRLRLKGEAQRTIGPTRKSDALPHKFTLEMLDVVQKVLRCRNHY 98
              ||.:.|.               |..|.:.....|...|    ..:|.|..|.|:::.:|:|:|
Zfish    66 ATEGTETHQ---------------RRSGVSSNGEKPAESS----KPYTPEQADAVRRIKQCKNYY 111

  Fly    99 EVLRISHHATYSEVKRAYHKLALRLHPDKNKSPGAEQAFR 138
            |:|.:...|:..::|:||.||||:.|||||.:|||.:||:
Zfish   112 EILGVQKDASEDDLKKAYRKLALKFHPDKNHAPGATEAFK 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30156NP_001260752.1 DnaJ 96..157 CDD:278647 22/43 (51%)
DUF1977 237..334 CDD:286411
dnajb12bNP_001082977.1 DnaJ 109..>151 CDD:278647 21/41 (51%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589201
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1173544at2759
OrthoFinder 1 1.000 - - FOG0001005
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR43908
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.