DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment galla-1 and CIA2

DIOPT Version :9

Sequence 1:NP_001286642.1 Gene:galla-1 / 246485 FlyBaseID:FBgn0034543 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_011990.1 Gene:CIA2 / 856522 SGDID:S000001164 Length:231 Species:Saccharomyces cerevisiae


Alignment Length:165 Identity:68/165 - (41%)
Similarity:101/165 - (61%) Gaps:9/165 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 DEL--VRKTSQMSMDDEAI-AFGEDALLHELGYKNQ----TELQETIYDLLRGIRDPEKPCTLED 115
            |:|  :|...:::.|:::: |..||..:...|.:.:    .:.|| ||||:..|.|||.|.:|..
Yeast    64 DKLLSIRIPPELTSDEDSLPAESEDESVAGGGKEEEEPDLIDAQE-IYDLIAHISDPEHPLSLGQ 127

  Fly   116 LNVVYEDGIFVMPPTRSN-VSVVRIEFNPTVPHCSLATLIGLCIRVKVERGLPHNIKLDIYIKKG 179
            |:||..:.|.|......| ::.|.|:..||:.||||||||||.|||::||.||...::.|.:|||
Yeast   128 LSVVNLEDIDVHDSGNQNEMAEVVIKITPTITHCSLATLIGLGIRVRLERSLPPRFRITILLKKG 192

  Fly   180 AHQTEEEINKQINDKERIAAAMENPNLRDLVENCI 214
            .|.:|.::|||:|||||:|||.||..|..:|...:
Yeast   193 THDSENQVNKQLNDKERVAAACENEQLLGVVSKML 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
galla-1NP_001286642.1 DUF59 <94..214 CDD:294611 60/120 (50%)
CIA2NP_011990.1 COG5133 1..231 CDD:227462 68/165 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345357
Domainoid 1 1.000 48 1.000 Domainoid score I3008
eggNOG 1 0.900 - - E1_COG5133
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001710
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.740

Return to query results.
Submit another query.