DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment galla-1 and AT3G09380

DIOPT Version :9

Sequence 1:NP_001286642.1 Gene:galla-1 / 246485 FlyBaseID:FBgn0034543 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_187549.2 Gene:AT3G09380 / 820096 AraportID:AT3G09380 Length:149 Species:Arabidopsis thaliana


Alignment Length:116 Identity:54/116 - (46%)
Similarity:75/116 - (64%) Gaps:5/116 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 LRGIRDPEKP-CTLEDLNVVYEDGIFVMPPTRSNVSVVRIEFNPTVPHCSLATLIGLCIRVKVER 164
            :|.|:|||.| .:||||||:.|:.:.|    ..:.|.|||.|.||:|||.|.|.|||||.||:.:
plant    36 IRDIKDPEHPELSLEDLNVLTEESVEV----DDHKSYVRITFTPTLPHCHLPTHIGLCILVKLVQ 96

  Fly   165 GLPHNIKLDIYIKKGAHQTEEEINKQINDKERIAAAMENPNLRDLVENCIK 215
            .||...|:|:.:..|:|..|..:|||:.||||:.||:|||.|..|:...::
plant    97 SLPARFKVDVRVAPGSHDKETTVNKQLGDKERVTAALENPELVALLNKMMQ 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
galla-1NP_001286642.1 DUF59 <94..214 CDD:294611 54/113 (48%)
AT3G09380NP_187549.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5133
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1408004at2759
OrthoFinder 1 1.000 - - FOG0001710
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.