DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment galla-1 and Ciao2b

DIOPT Version :9

Sequence 1:NP_001286642.1 Gene:galla-1 / 246485 FlyBaseID:FBgn0034543 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_001138326.1 Gene:Ciao2b / 680987 RGDID:1585802 Length:165 Species:Rattus norvegicus


Alignment Length:193 Identity:75/193 - (38%)
Similarity:102/193 - (52%) Gaps:39/193 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 GGDSGRAGGTGSSESGTGSSSASISGRSQNADELVRKTS-----QMSMDDEAIAFGEDALLHELG 86
            ||..|..||                |..:||:.|:.:.|     ....:||.:....||      
  Rat     3 GGGGGGGGG----------------GLLENANPLIYERSGERPVTAGEEDEEVPDSIDA------ 45

  Fly    87 YKNQTELQETIYDLLRGIRDPEKPCTLEDLNVVYEDGIFVMPPTRSNVSVVRIEFNPTVPHCSLA 151
                    ..|:||:|.|.|||.|.|||:||||.:..|.|..|.    |.|.:.|.||:||||:|
  Rat    46 --------REIFDLIRSINDPEHPLTLEELNVVEQVRIQVSDPE----STVAVAFTPTIPHCSMA 98

  Fly   152 TLIGLCIRVKVERGLPHNIKLDIYIKKGAHQTEEEINKQINDKERIAAAMENPNLRDLVENCI 214
            |||||.|:||:.|.||...|:|::|..|.|.:|..:|||:.||||:|||:||.:|.::|..|:
  Rat    99 TLIGLSIKVKLLRSLPQRFKMDVHITPGTHASEHAVNKQLADKERVAAALENTHLLEVVNQCL 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
galla-1NP_001286642.1 DUF59 <94..214 CDD:294611 60/119 (50%)
Ciao2bNP_001138326.1 FeS_assembly_P <25..163 CDD:412662 66/155 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5133
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1408004at2759
OrthoFinder 1 1.000 - - FOG0001710
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.