DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment galla-1 and ciao2b

DIOPT Version :9

Sequence 1:NP_001286642.1 Gene:galla-1 / 246485 FlyBaseID:FBgn0034543 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_001128276.1 Gene:ciao2b / 548360 XenbaseID:XB-GENE-5959878 Length:160 Species:Xenopus tropicalis


Alignment Length:168 Identity:72/168 - (42%)
Similarity:104/168 - (61%) Gaps:21/168 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 GRSQ--NADELVRKTS---QMSMDDEAIAFGEDALLHELGYKNQTELQETIYDLLRGIRDPEKPC 111
            |.||  ||:.|:.:.:   |::..:|    .|||       .::.:.:| |:||:|.|.|||.|.
 Frog     3 GGSQLENANPLIYRRAGERQVTAQEE----DEDA-------PDRIDDRE-IFDLIRCINDPEHPL 55

  Fly   112 TLEDLNVVYEDGIFVMPPTRSNVSVVRIEFNPTVPHCSLATLIGLCIRVKVERGLPHNIKLDIYI 176
            |||:||||.|    :........|.|.:||.||:||||:||||||.|:||:.|.||...|:|::|
 Frog    56 TLEELNVVEE----IRVKVSDEESTVSVEFTPTIPHCSMATLIGLSIKVKLLRSLPERFKVDVHI 116

  Fly   177 KKGAHQTEEEINKQINDKERIAAAMENPNLRDLVENCI 214
            ..|.|.:|..:|||:.||||:|||:||.:|.::|..|:
 Frog   117 TPGTHASEHAVNKQLADKERVAAALENSHLLEVVNQCL 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
galla-1NP_001286642.1 DUF59 <94..214 CDD:294611 60/119 (50%)
ciao2bNP_001128276.1 FeS_assembly_P 5..154 CDD:382298 70/164 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1408004at2759
OrthoFinder 1 1.000 - - FOG0001710
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.