DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment galla-1 and AT3G50845

DIOPT Version :9

Sequence 1:NP_001286642.1 Gene:galla-1 / 246485 FlyBaseID:FBgn0034543 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_001078267.1 Gene:AT3G50845 / 5008077 AraportID:AT3G50845 Length:154 Species:Arabidopsis thaliana


Alignment Length:165 Identity:68/165 - (41%)
Similarity:95/165 - (57%) Gaps:20/165 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 NADELV--RKTSQMSMDDEAIAFGEDALLHELGYKNQTELQETIYDLLRGIRDPEKPCTLEDLNV 118
            ||:.:|  :|...:..:|:....|.|.|              .|||.:|.|||||.|.|||.|.|
plant     7 NANPVVQAKKEGLVRREDQYRDDGVDPL--------------EIYDYVRDIRDPEHPYTLEQLRV 57

  Fly   119 VYEDGIFVMPPTRSNVSVVRIEFNPTVPHCSLATLIGLCIRVKVERGLPHNIKLDIYIKKGAHQT 183
            |.|:.:.|    ...:..:.|.|.||:.|||:|.:||||:|.|::..|..:.|:||.:..|:|..
plant    58 VSEESVTV----DDKLDRILITFTPTIQHCSMANIIGLCLRAKLKECLQLHYKVDIRVSPGSHAD 118

  Fly   184 EEEINKQINDKERIAAAMENPNLRDLVENCIKDEE 218
            |..:|||:|||||:.||:||||||.||:.||..:|
plant   119 EVSVNKQLNDKERVVAALENPNLRQLVDECIYSDE 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
galla-1NP_001286642.1 DUF59 <94..214 CDD:294611 57/119 (48%)
AT3G50845NP_001078267.1 DUF59 <29..149 CDD:294611 60/137 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 66 1.000 Domainoid score I3579
eggNOG 1 0.900 - - E1_COG5133
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H12252
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1408004at2759
OrthoFinder 1 1.000 - - FOG0001710
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.820

Return to query results.
Submit another query.