DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment galla-1 and ciao2a

DIOPT Version :9

Sequence 1:NP_001286642.1 Gene:galla-1 / 246485 FlyBaseID:FBgn0034543 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_998192.1 Gene:ciao2a / 406300 ZFINID:ZDB-GENE-040426-1965 Length:157 Species:Danio rerio


Alignment Length:178 Identity:82/178 - (46%)
Similarity:113/178 - (63%) Gaps:26/178 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 SGTGSSSASISGRSQNADELVRKTSQMSMDDEAIAFGEDALLHELGYKNQTELQETIYDLLRGIR 105
            ||..|.:..::|.|...::..||    .|:::|:                     .:||::|.||
Zfish     5 SGLLSKALFLTGLSNETNDKRRK----KMEEKAL---------------------EVYDVIRTIR 44

  Fly   106 DPEKPCTLEDLNVVYEDGIFVMPPTRSNVSVVRIEFNPTVPHCSLATLIGLCIRVKVERGLPHNI 170
            |||||.|||:|:||.|..:.|.........:| |:|:|||||||||||||||::||::|.||...
Zfish    45 DPEKPNTLEELDVVTEKCVEVQELGDDEYLIV-IKFSPTVPHCSLATLIGLCLQVKLQRCLPFKH 108

  Fly   171 KLDIYIKKGAHQTEEEINKQINDKERIAAAMENPNLRDLVENCIKDEE 218
            ||:|||.:|.|..||:||||||||||:||||||||||::||.|:.:.:
Zfish   109 KLEIYITEGTHSIEEDINKQINDKERVAAAMENPNLREIVEQCVTEPD 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
galla-1NP_001286642.1 DUF59 <94..214 CDD:294611 72/119 (61%)
ciao2aNP_998192.1 DUF59 <18..152 CDD:294611 77/159 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 75 1.000 Domainoid score I9066
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H12252
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1408004at2759
OrthoFinder 1 1.000 - - FOG0001710
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.