DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment galla-1 and galla-2

DIOPT Version :9

Sequence 1:NP_001286642.1 Gene:galla-1 / 246485 FlyBaseID:FBgn0034543 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_648416.1 Gene:galla-2 / 39221 FlyBaseID:FBgn0036107 Length:156 Species:Drosophila melanogaster


Alignment Length:118 Identity:61/118 - (51%)
Similarity:80/118 - (67%) Gaps:4/118 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 IYDLLRGIRDPEKPCTLEDLNVVYEDGIFVMPPTRSNVSVVRIEFNPTVPHCSLATLIGLCIRVK 161
            |:||:|.|.|||.|.|||:|:||.||.|.:.....|    |.|.|.||:||||:||||||.||||
  Fly    39 IFDLIRNINDPEHPLTLEELHVVQEDLIRINDSQNS----VHISFTPTIPHCSMATLIGLSIRVK 99

  Fly   162 VERGLPHNIKLDIYIKKGAHQTEEEINKQINDKERIAAAMENPNLRDLVENCI 214
            :.|.||...|:.:.|..|.|.:|..:|||:.||||:|||:||.:|.:::..||
  Fly   100 LLRSLPPRFKVTVEITPGTHASELAVNKQLADKERVAAALENNHLAEVINQCI 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
galla-1NP_001286642.1 DUF59 <94..214 CDD:294611 59/116 (51%)
galla-2NP_648416.1 DUF59 1..154 CDD:294611 61/118 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462128
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5133
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D111144at33392
OrthoFinder 1 1.000 - - FOG0001710
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12377
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.