DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment galla-1 and Ciao2a

DIOPT Version :9

Sequence 1:NP_001286642.1 Gene:galla-1 / 246485 FlyBaseID:FBgn0034543 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_001008328.1 Gene:Ciao2a / 300797 RGDID:1307481 Length:160 Species:Rattus norvegicus


Alignment Length:139 Identity:80/139 - (57%)
Similarity:101/139 - (72%) Gaps:5/139 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 ELGYKNQTELQE----TIYDLLRGIRDPEKPCTLEDLNVVYEDGIFVMPPTRSNVSVVRIEFNPT 144
            |.|...|..:.|    .:|||:|.|||||||.|||:|.||.|..:.|...:..:..|: |:|.||
  Rat    23 EQGAAWQPRIMEEKALEVYDLIRTIRDPEKPNTLEELEVVTESCVEVQEISEDDYLVI-IKFTPT 86

  Fly   145 VPHCSLATLIGLCIRVKVERGLPHNIKLDIYIKKGAHQTEEEINKQINDKERIAAAMENPNLRDL 209
            |||||||||||||:|||::|.||...||:|||.:|.|.|||:||||||||||:||||||||||::
  Rat    87 VPHCSLATLIGLCLRVKLQRCLPFKHKLEIYISEGTHSTEEDINKQINDKERVAAAMENPNLREI 151

  Fly   210 VENCIKDEE 218
            ||.|:.:.:
  Rat   152 VEQCVLEPD 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
galla-1NP_001286642.1 DUF59 <94..214 CDD:294611 76/123 (62%)
Ciao2aNP_001008328.1 FeS_assembly_P <39..156 CDD:412662 75/117 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166349354
Domainoid 1 1.000 81 1.000 Domainoid score I8366
eggNOG 1 0.900 - - E1_COG5133
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H12252
Inparanoid 1 1.050 155 1.000 Inparanoid score I4209
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1408004at2759
OrthoFinder 1 1.000 - - FOG0001710
OrthoInspector 1 1.000 - - oto96321
orthoMCL 1 0.900 - - OOG6_108130
Panther 1 1.100 - - LDO PTHR12377
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X10503
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.760

Return to query results.
Submit another query.