DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment galla-1 and SPAC144.16

DIOPT Version :9

Sequence 1:NP_001286642.1 Gene:galla-1 / 246485 FlyBaseID:FBgn0034543 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_594677.1 Gene:SPAC144.16 / 2542897 PomBaseID:SPAC144.16 Length:179 Species:Schizosaccharomyces pombe


Alignment Length:180 Identity:68/180 - (37%)
Similarity:102/180 - (56%) Gaps:14/180 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 SASISGRSQNADELVRKTSQMSMDDEAIAFGEDALLHELGYKNQTELQE--------TIYDLLRG 103
            ||::...:....||.:..|::..:::.:.......|.|: ...||.::|        .|||||..
pombe     2 SANLQNENPEVKELNQLPSRVEEEEDLLLSSTKQWLTEI-ESEQTNIKEERDPIDPQEIYDLLAK 65

  Fly   104 IRDPEKPCTLEDLNVVYEDGIFVMPPTRSNVSVVRIEFNPTVPHCSLATLIGLCIRVKVERGLPH 168
            |.|||.|.||..|:||..:.|.|:.....: |.:.:...||:||||:.|||||||||::||.||.
pombe    66 INDPEHPLTLAQLSVVKLEDIEVVDNVEGD-SYITVHITPTIPHCSMCTLIGLCIRVRLERCLPP 129

  Fly   169 NIKLDIYIKKGAHQTEEEINKQINDKERIAAAMENPN----LRDLVENCI 214
            ...:|:.:|||.|.:|.::|||:|||||:|||.||..    |..::..|:
pombe   130 RFHVDVKVKKGTHASESQVNKQLNDKERVAAACENEQLLSVLNGMMATCV 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
galla-1NP_001286642.1 DUF59 <94..214 CDD:294611 58/131 (44%)
SPAC144.16NP_594677.1 COG5133 2..179 CDD:227462 67/178 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5133
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001710
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.