DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment galla-1 and ciao-2B

DIOPT Version :9

Sequence 1:NP_001286642.1 Gene:galla-1 / 246485 FlyBaseID:FBgn0034543 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_499777.1 Gene:ciao-2B / 185814 WormBaseID:WBGene00009736 Length:160 Species:Caenorhabditis elegans


Alignment Length:122 Identity:63/122 - (51%)
Similarity:81/122 - (66%) Gaps:2/122 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 IYDLLRGIRDPEKPCTLEDLNVVYEDGIFVMPPTRSNVSVVRIEFNPTVPHCSLATLIGLCIRVK 161
            |:||:|.|.|||.|.|||.||||.|:.|.|.  .....:.|::.|.||:||||:||||||.||||
 Worm    41 IFDLIRDINDPEHPYTLEQLNVVQEELIKVF--IDEEETFVKVNFTPTIPHCSMATLIGLAIRVK 103

  Fly   162 VERGLPHNIKLDIYIKKGAHQTEEEINKQINDKERIAAAMENPNLRDLVENCIKDEE 218
            :.|.|...:|:.:.|..|:|.|||.||:|:.||||:||||||..|...|..|::..|
 Worm   104 LLRSLHPKVKVSVSITPGSHSTEESINRQLADKERVAAAMENQGLMHAVNECLRVPE 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
galla-1NP_001286642.1 DUF59 <94..214 CDD:294611 61/116 (53%)
ciao-2BNP_499777.1 DUF59 <34..156 CDD:294611 61/116 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5133
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1408004at2759
OrthoFinder 1 1.000 - - FOG0001710
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.