DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Serpina1 and Spn42Dd

DIOPT Version :9

Sequence 1:NP_071964.2 Gene:Serpina1 / 24648 RGDID:3326 Length:411 Species:Rattus norvegicus
Sequence 2:NP_001163067.1 Gene:Spn42Dd / 49808 FlyBaseID:FBgn0028988 Length:372 Species:Drosophila melanogaster


Alignment Length:365 Identity:113/365 - (30%)
Similarity:183/365 - (50%) Gaps:28/365 - (7%)


- Green bases have known domain annotations that are detailed below.


  Rat    58 ELVHQSNTS-NIFFSPMSITTAFAMLSLGSKGDTRKQILEGLEFNLTQIPEAD---IHKAFHHLL 118
            :|:.:|:|: |:..||:||.|..:|:.:|::|.|.|::...|     .:|..|   :...:..||
  Fly    23 QLLSKSHTNQNLVVSPVSIETILSMVFMGAEGSTAKELQSAL-----GLPSEDKEAVAARYGALL 82

  Rat   119 QTLNRPDSELQLNTGNGLFVNKNLKLVEKFLEEVKNNYHSEAFSVNFADSEEAKKVINDYVEKGT 183
            ..|...:....|...|.::||....|.:.:...|:..:.|||.|::..:...|.:.||.:|...|
  Fly    83 NDLQGQEEGPILKLANRIYVNDQYSLNQNYNLAVREPFKSEAESISLTNGPVAAERINQWVLDQT 147

  Rat   184 QGKIVDLMK--QLDEDTVFALVNYIFFKGKWKRPFNPEHTRDADFHVDKSTTVKVPMMNRLGMFD 246
            .|||..::.  .:..|....|||.|:|||:|:..|:|..||.:.|.|..:.:|.|.||.::|.|.
  Fly   148 SGKIKGMIDPGSMTSDVKALLVNAIYFKGQWESKFDPAKTRASTFQVTANKSVPVQMMAQMGTFR 212

  Rat   247 MHYCSTLSSWVLMMDYLGN--ATAIFLLPDDGKMQHLEQTL---TKDLISRFLLNRQTRSAILYF 306
            .:|...|.:.|:.:.||.:  :..|||..:...:..||:.:   .:.|::        :...|..
  Fly   213 ANYFRDLDAQVIELPYLNSNLSMTIFLPREVEGLSALEEKIVGFARPLVA--------KEVYLKL 269

  Rat   307 PKLSISGTYNLKTLLSSLGITRVFNNDADLSGITED-APLKLSQAVHKAVLTLDERGTEAAGATV 370
            ||..|.....||..|..|||..:|.:.:||||:..| :..|:||..|||.|.::|.|.||||||.
  Fly   270 PKFKIEFRDELKETLEKLGIRELFTDKSDLSGLFADKSGGKVSQVSHKAFLEVNEEGAEAAGATS 334

  Rat   371 VEAVPMS-LPPQVKFDHPFIFMIVESETQSPLFVGKVIDP 409
            |.....: ....:..||||.|:|.::.|  ..|.|:|:.|
  Fly   335 VAVTNRAGFSTFLMADHPFAFVIRDANT--IYFQGRVVSP 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Serpina1NP_071964.2 alpha-1-antitrypsin_like 49..406 CDD:239011 111/360 (31%)
RCL 367..386 4/19 (21%)
Spn42DdNP_001163067.1 SERPIN 16..369 CDD:238101 111/360 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.