DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Serpina1 and Spn88Eb

DIOPT Version :9

Sequence 1:NP_071964.2 Gene:Serpina1 / 24648 RGDID:3326 Length:411 Species:Rattus norvegicus
Sequence 2:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster


Alignment Length:402 Identity:98/402 - (24%)
Similarity:174/402 - (43%) Gaps:44/402 - (10%)


- Green bases have known domain annotations that are detailed below.


  Rat    41 YRKISSNLADFAFSLYRELVHQSNTSNIFFSPMSITTAFAMLSLGSKGDTRKQILEGLEFNLTQI 105
            :.:|.....||:.:|.:::.....:.|:||||.|...|..:....|...|.:::.:.|.....  
  Fly    31 FSQIFKGERDFSLALMKQIREIYPSGNLFFSPFSTYNALLLAYFSSSEQTERELAQALNLGWA-- 93

  Rat   106 PEADIHKAFHHLLQTL-NRPD------SELQLNTGNGLFVNKNLKLVEKFLEEVKNNYHSEAFSV 163
                ::|....:..|| .|.|      |.::|::.|.:||::.:.:..||    ....:.....:
  Fly    94 ----LNKQQVLVSYTLAQRQDEFRWRQSPMELSSANRIFVDRTINVSNKF----NTLLYGATKEL 150

  Rat   164 NFA-DSEEAKKVINDYVEKGTQGKIVDLM--KQLDEDTVFALVNYIFFKGKWKRPFNPEHTRDAD 225
            :|. |.|...|.|||::...|..:|.|::  :::...|:..|.|..:.||:|...|..|.|....
  Fly   151 DFKNDPETGLKEINDWIADKTHNQIRDMLSSEEITPHTMLVLANAAYMKGQWLSQFKVEETALKP 215

  Rat   226 FHVDKSTTVKVPMMNRLGMFDMHYCSTLSSWVLMMDY----------------LGNATAIFLLPD 274
            |.:::.....|.||::.|.|.|.....|.|.::.:.|                ..:.:.|.:||:
  Fly   216 FFINEREQEMVYMMHKTGAFKMTIDEGLQSQIIKLPYRTIYKSKETHISTPESKSDISMIIILPN 280

  Rat   275 DGK--MQHLEQTLTKDLISRFLLNRQTRSAILYFPKLSISGTYNLKTLLSSLGITRVFNNDADLS 337
            ..|  :..:...|..|.:.::......:...|..||........|..:||.:|:..:|..:|...
  Fly   281 SNKISLNRVISRLNADSVKKWFERALPQKIELSLPKFQFEQRLELTPILSLMGVNTMFTRNATFG 345

  Rat   338 GITEDAPLKL--SQAVHKAVLTLDERGTEAAGATVVEAVPMSLPPQ-VKF--DHPFIFMIVESET 397
            .:|.| |:.|  ..|.|.|.:.:||.|:.||.||::.....|..|. .||  :|||:|:|.:.:.
  Fly   346 DLTAD-PISLVIDDAQHLAKIKVDEVGSTAAAATILLVSRSSRQPDPTKFNCNHPFVFLIYDEKV 409

  Rat   398 QSPLFVGKVIDP 409
            .:.||.|...||
  Fly   410 DTILFAGVYSDP 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Serpina1NP_071964.2 alpha-1-antitrypsin_like 49..406 CDD:239011 95/389 (24%)
RCL 367..386 6/21 (29%)
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 95/391 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.