DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30109 and MDM35

DIOPT Version :9

Sequence 1:NP_725706.1 Gene:CG30109 / 246461 FlyBaseID:FBgn0050109 Length:88 Species:Drosophila melanogaster
Sequence 2:NP_012870.1 Gene:MDM35 / 853812 SGDID:S000007243 Length:86 Species:Saccharomyces cerevisiae


Alignment Length:87 Identity:31/87 - (35%)
Similarity:49/87 - (56%) Gaps:10/87 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SIGEDCNELKKQYDACFNSWFSEGFLKGQTDDSGCAPIFRVYQECVKRAMREQKIE--LREVGSE 65
            |...:|.:||.:||:|||.|:||.||||::.::.|:..:..|..||..|:.:|.|:  |.|...|
Yeast     8 SFAPECTDLKTKYDSCFNEWYSEKFLKGKSVENECSKQWYAYTTCVNAALVKQGIKPALDEAREE 72

  Fly    66 YCTGSEYDNASSSGGKTQPKTK 87
                :.::|    |||.:...|
Yeast    73 ----APFEN----GGKLKEVDK 86

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30109NP_725706.1 UPF0203 2..58 CDD:283029 22/54 (41%)
MDM35NP_012870.1 UPF0203 7..75 CDD:398772 26/70 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 57 1.000 Domainoid score I2654
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 57 1.000 Inparanoid score I1793
Isobase 1 0.950 - 0 Normalized mean entropy S1441
OMA 1 1.010 - - QHG53222
OrthoFinder 1 1.000 - - FOG0004470
OrthoInspector 1 1.000 - - otm46479
orthoMCL 1 0.900 - - OOG6_104453
Panther 1 1.100 - - LDO PTHR46403
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1722
SonicParanoid 1 1.000 - - X3757
TreeFam 00.000 Not matched by this tool.
1211.950

Return to query results.
Submit another query.