DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30109 and Triap1

DIOPT Version :9

Sequence 1:NP_725706.1 Gene:CG30109 / 246461 FlyBaseID:FBgn0050109 Length:88 Species:Drosophila melanogaster
Sequence 2:NP_081209.1 Gene:Triap1 / 69076 MGIID:1916326 Length:76 Species:Mus musculus


Alignment Length:88 Identity:34/88 - (38%)
Similarity:53/88 - (60%) Gaps:12/88 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNSIGEDCNELKKQYDACFNSWFSEGFLKGQTDDSGCAPIFRVYQECVKRAMREQKIELREVGSE 65
            |||:||.|.::|::||.|||.||:|.||||......|..:|:.||:||::|::|::|.:.     
Mouse     1 MNSVGEACTDMKREYDQCFNRWFAEKFLKGDGSGDPCTDLFKRYQQCVQKAIKEKEIPIE----- 60

  Fly    66 YCTGSEYDNASSSGGKTQPKTKS 88
               |.|:    ...||.:|:..|
Mouse    61 ---GLEF----MGHGKEKPENSS 76

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30109NP_725706.1 UPF0203 2..58 CDD:283029 26/55 (47%)
Triap1NP_081209.1 UPF0203 2..68 CDD:398772 29/77 (38%)
Cx9C motif 1. /evidence=ECO:0000255|PROSITE-ProRule:PRU01150 8..18 4/9 (44%)
Cx9C motif 2. /evidence=ECO:0000255|PROSITE-ProRule:PRU01150 37..47 4/9 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 76 1.000 Domainoid score I8956
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 80 1.000 Inparanoid score I5200
Isobase 1 0.950 - 0 Normalized mean entropy S1441
OMA 1 1.010 - - QHG53222
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004470
OrthoInspector 1 1.000 - - otm42356
orthoMCL 1 0.900 - - OOG6_104453
Panther 1 1.100 - - LDO PTHR46403
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1722
SonicParanoid 1 1.000 - - X3757
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1312.950

Return to query results.
Submit another query.