DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30109 and triap1

DIOPT Version :9

Sequence 1:NP_725706.1 Gene:CG30109 / 246461 FlyBaseID:FBgn0050109 Length:88 Species:Drosophila melanogaster
Sequence 2:NP_001016268.1 Gene:triap1 / 549022 XenbaseID:XB-GENE-949263 Length:78 Species:Xenopus tropicalis


Alignment Length:88 Identity:32/88 - (36%)
Similarity:55/88 - (62%) Gaps:14/88 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNSIGEDCNELKKQYDACFNSWFSEGFLKGQTDDSGCAPIFRVYQECVKRAMREQKIELREVGSE 65
            |||:||:|.::|::||.|||.||:|.||||:.....|..:||.|::||::|::::.|.:.  |.:
 Frog     1 MNSVGEECTDMKREYDQCFNRWFAEKFLKGECSGDPCTELFRRYRDCVQKAIKDKDIPVD--GVD 63

  Fly    66 YCTGSEYDNASSSGGKTQPKTKS 88
            :.            |.::.||:|
 Frog    64 FM------------GPSKSKTES 74

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30109NP_725706.1 UPF0203 2..58 CDD:283029 25/55 (45%)
triap1NP_001016268.1 UPF0203 2..67 CDD:368360 27/78 (35%)
Cx9C motif 1. /evidence=ECO:0000255|PROSITE-ProRule:PRU01150 8..18 4/9 (44%)
Cx9C motif 2. /evidence=ECO:0000255|PROSITE-ProRule:PRU01150 37..47 4/9 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 77 1.000 Domainoid score I8728
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 81 1.000 Inparanoid score I5041
OMA 1 1.010 - - QHG53222
OrthoDB 1 1.010 - - D1552088at2759
OrthoFinder 1 1.000 - - FOG0004470
OrthoInspector 1 1.000 - - otm47466
Panther 1 1.100 - - LDO PTHR46403
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1722
SonicParanoid 1 1.000 - - X3757
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1212.110

Return to query results.
Submit another query.