DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30109 and TRIAP1

DIOPT Version :9

Sequence 1:NP_725706.1 Gene:CG30109 / 246461 FlyBaseID:FBgn0050109 Length:88 Species:Drosophila melanogaster
Sequence 2:NP_057483.1 Gene:TRIAP1 / 51499 HGNCID:26937 Length:76 Species:Homo sapiens


Alignment Length:88 Identity:34/88 - (38%)
Similarity:54/88 - (61%) Gaps:12/88 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNSIGEDCNELKKQYDACFNSWFSEGFLKGQTDDSGCAPIFRVYQECVKRAMREQKIELREVGSE 65
            |||:||.|.::|::||.|||.||:|.||||.:....|..:|:.||:||::|::|::|.:.     
Human     1 MNSVGEACTDMKREYDQCFNRWFAEKFLKGDSSGDPCTDLFKRYQQCVQKAIKEKEIPIE----- 60

  Fly    66 YCTGSEYDNASSSGGKTQPKTKS 88
               |.|:    ...||.:|:..|
Human    61 ---GLEF----MGHGKEKPENSS 76

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30109NP_725706.1 UPF0203 2..58 CDD:283029 26/55 (47%)
TRIAP1NP_057483.1 UPF0203 2..68 CDD:398772 29/77 (38%)
Cx9C motif 1. /evidence=ECO:0000255|PROSITE-ProRule:PRU01150 8..18 4/9 (44%)
Cx9C motif 2. /evidence=ECO:0000255|PROSITE-ProRule:PRU01150 37..47 4/9 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 77 1.000 Domainoid score I8896
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 81 1.000 Inparanoid score I5216
Isobase 1 0.950 - 0 Normalized mean entropy S1441
OMA 1 1.010 - - QHG53222
OrthoDB 1 1.010 - - D1552088at2759
OrthoFinder 1 1.000 - - FOG0004470
OrthoInspector 1 1.000 - - otm40290
orthoMCL 1 0.900 - - OOG6_104453
Panther 1 1.100 - - LDO PTHR46403
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1722
SonicParanoid 1 1.000 - - X3757
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1312.960

Return to query results.
Submit another query.