DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30109 and CG30108

DIOPT Version :9

Sequence 1:NP_725706.1 Gene:CG30109 / 246461 FlyBaseID:FBgn0050109 Length:88 Species:Drosophila melanogaster
Sequence 2:NP_725705.2 Gene:CG30108 / 246460 FlyBaseID:FBgn0050108 Length:88 Species:Drosophila melanogaster


Alignment Length:88 Identity:59/88 - (67%)
Similarity:72/88 - (81%) Gaps:0/88 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNSIGEDCNELKKQYDACFNSWFSEGFLKGQTDDSGCAPIFRVYQECVKRAMREQKIELREVGSE 65
            |:|:||||||||:||||||||||||.|||||.|||.|||||||||||||||::|:||:|:|:...
  Fly     1 MSSVGEDCNELKQQYDACFNSWFSERFLKGQMDDSACAPIFRVYQECVKRAIKEKKIDLQEIDPI 65

  Fly    66 YCTGSEYDNASSSGGKTQPKTKS 88
            :.||.|.:||:.|..|.|...:|
  Fly    66 FETGLEENNANRSDAKQQQAGES 88

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30109NP_725706.1 UPF0203 2..58 CDD:283029 46/55 (84%)
CG30108NP_725705.2 UPF0203 2..58 CDD:283029 46/55 (84%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441210
Domainoid 1 1.000 50 1.000 Domainoid score I4389
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 50 1.000 Inparanoid score I2634
Isobase 1 0.950 - 0 Normalized mean entropy S1441
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1552088at2759
OrthoFinder 1 1.000 - - FOG0004470
OrthoInspector 1 1.000 - - otm26261
orthoMCL 1 0.900 - - OOG6_104453
Panther 1 1.100 - - P PTHR46403
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1722
SonicParanoid 1 1.000 - - X3757
1211.880

Return to query results.
Submit another query.