powered by:
Protein Alignment CG30109 and mdmh-35
DIOPT Version :9
Sequence 1: | NP_725706.1 |
Gene: | CG30109 / 246461 |
FlyBaseID: | FBgn0050109 |
Length: | 88 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_495651.1 |
Gene: | mdmh-35 / 174264 |
WormBaseID: | WBGene00011635 |
Length: | 103 |
Species: | Caenorhabditis elegans |
Alignment Length: | 73 |
Identity: | 24/73 - (32%) |
Similarity: | 40/73 - (54%) |
Gaps: | 8/73 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MNSIGEDCNELKKQYDACFNSWFSEGFL----KGQTDDSGCAPIFRVYQECVKRAMREQK---IE 58
|:||..:|:.||:.||.||..:|.: |: :.|...:.|..:..||:.||:..:..|: |:
Worm 6 MSSIFPECDHLKQIYDKCFTEFFQK-FITPNYRHQYAVNPCERLHDVYKRCVEERLATQRPFEID 69
Fly 59 LREVGSEY 66
|.|:..||
Worm 70 LDEIRKEY 77
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
1 |
1.000 |
- |
- |
|
|
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
1 |
1.050 |
41 |
1.000 |
Inparanoid score |
I4154 |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1552088at2759 |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0004470 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
1 |
0.900 |
- |
- |
|
OOG6_104453 |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
6 | 5.870 |
|
Return to query results.
Submit another query.