DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30109 and mdmh-35

DIOPT Version :9

Sequence 1:NP_725706.1 Gene:CG30109 / 246461 FlyBaseID:FBgn0050109 Length:88 Species:Drosophila melanogaster
Sequence 2:NP_495651.1 Gene:mdmh-35 / 174264 WormBaseID:WBGene00011635 Length:103 Species:Caenorhabditis elegans


Alignment Length:73 Identity:24/73 - (32%)
Similarity:40/73 - (54%) Gaps:8/73 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNSIGEDCNELKKQYDACFNSWFSEGFL----KGQTDDSGCAPIFRVYQECVKRAMREQK---IE 58
            |:||..:|:.||:.||.||..:|.: |:    :.|...:.|..:..||:.||:..:..|:   |:
 Worm     6 MSSIFPECDHLKQIYDKCFTEFFQK-FITPNYRHQYAVNPCERLHDVYKRCVEERLATQRPFEID 69

  Fly    59 LREVGSEY 66
            |.|:..||
 Worm    70 LDEIRKEY 77

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30109NP_725706.1 UPF0203 2..58 CDD:283029 18/62 (29%)
mdmh-35NP_495651.1 UPF0203 7..79 CDD:368360 23/72 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 41 1.000 Inparanoid score I4154
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1552088at2759
OrthoFinder 1 1.000 - - FOG0004470
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104453
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.870

Return to query results.
Submit another query.