DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30108 and AT4G33100

DIOPT Version :9

Sequence 1:NP_725705.2 Gene:CG30108 / 246460 FlyBaseID:FBgn0050108 Length:88 Species:Drosophila melanogaster
Sequence 2:NP_195036.1 Gene:AT4G33100 / 829447 AraportID:AT4G33100 Length:92 Species:Arabidopsis thaliana


Alignment Length:79 Identity:24/79 - (30%)
Similarity:43/79 - (54%) Gaps:6/79 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 CNELKQQYDACFNSWFSERFLKGQMDDSACAPIFRVYQECVKRAIKEKKIDLQEIDPIFETGLEE 72
            |.:|:..|..|||.|:||:|:|||.|...|...::.|::|:     .:.:|.:.:..|.|...|.
plant    19 CADLRNAYHNCFNKWYSEKFVKGQWDKEECVAEWKKYRDCL-----SENLDGKLLTRILEVDGEL 78

  Fly    73 NNANR-SDAKQQQA 85
            |...: :|:|:..:
plant    79 NPTKQATDSKESSS 92

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30108NP_725705.2 UPF0203 2..58 CDD:283029 17/49 (35%)
AT4G33100NP_195036.1 PLN03079 2..92 CDD:178628 24/77 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 50 1.000 Domainoid score I4389
eggNOG 1 0.900 - - E1_KOG3481
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 50 1.000 Inparanoid score I2634
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1552088at2759
OrthoFinder 1 1.000 - - FOG0004470
OrthoInspector 1 1.000 - - otm3447
orthoMCL 1 0.900 - - OOG6_104453
Panther 1 1.100 - - O PTHR46403
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3757
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.830

Return to query results.
Submit another query.