DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30108 and TRIAP1

DIOPT Version :9

Sequence 1:NP_725705.2 Gene:CG30108 / 246460 FlyBaseID:FBgn0050108 Length:88 Species:Drosophila melanogaster
Sequence 2:NP_057483.1 Gene:TRIAP1 / 51499 HGNCID:26937 Length:76 Species:Homo sapiens


Alignment Length:63 Identity:31/63 - (49%)
Similarity:48/63 - (76%) Gaps:0/63 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSVGEDCNELKQQYDACFNSWFSERFLKGQMDDSACAPIFRVYQECVKRAIKEKKIDLQEID 63
            |:||||.|.::|::||.|||.||:|:||||......|..:|:.||:||::|||||:|.::.::
Human     1 MNSVGEACTDMKREYDQCFNRWFAEKFLKGDSSGDPCTDLFKRYQQCVQKAIKEKEIPIEGLE 63

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30108NP_725705.2 UPF0203 2..58 CDD:283029 29/55 (53%)
TRIAP1NP_057483.1 UPF0203 2..68 CDD:398772 30/62 (48%)
Cx9C motif 1. /evidence=ECO:0000255|PROSITE-ProRule:PRU01150 8..18 4/9 (44%)
Cx9C motif 2. /evidence=ECO:0000255|PROSITE-ProRule:PRU01150 37..47 4/9 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 77 1.000 Domainoid score I8896
eggNOG 1 0.900 - - E1_KOG3481
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 81 1.000 Inparanoid score I5216
Isobase 1 0.950 - 0 Normalized mean entropy S1441
OMA 1 1.010 - - QHG53222
OrthoDB 1 1.010 - - D1552088at2759
OrthoFinder 1 1.000 - - FOG0004470
OrthoInspector 1 1.000 - - otm40290
orthoMCL 1 0.900 - - OOG6_104453
Panther 1 1.100 - - O PTHR46403
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1722
SonicParanoid 1 1.000 - - X3757
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.820

Return to query results.
Submit another query.