Sequence 1: | NP_725705.2 | Gene: | CG30108 / 246460 | FlyBaseID: | FBgn0050108 | Length: | 88 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_057483.1 | Gene: | TRIAP1 / 51499 | HGNCID: | 26937 | Length: | 76 | Species: | Homo sapiens |
Alignment Length: | 63 | Identity: | 31/63 - (49%) |
---|---|---|---|
Similarity: | 48/63 - (76%) | Gaps: | 0/63 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MSSVGEDCNELKQQYDACFNSWFSERFLKGQMDDSACAPIFRVYQECVKRAIKEKKIDLQEID 63 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG30108 | NP_725705.2 | UPF0203 | 2..58 | CDD:283029 | 29/55 (53%) |
TRIAP1 | NP_057483.1 | UPF0203 | 2..68 | CDD:398772 | 30/62 (48%) |
Cx9C motif 1. /evidence=ECO:0000255|PROSITE-ProRule:PRU01150 | 8..18 | 4/9 (44%) | |||
Cx9C motif 2. /evidence=ECO:0000255|PROSITE-ProRule:PRU01150 | 37..47 | 4/9 (44%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 77 | 1.000 | Domainoid score | I8896 |
eggNOG | 1 | 0.900 | - | - | E1_KOG3481 | |
Hieranoid | 1 | 1.000 | - | - | ||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 81 | 1.000 | Inparanoid score | I5216 |
Isobase | 1 | 0.950 | - | 0 | Normalized mean entropy | S1441 |
OMA | 1 | 1.010 | - | - | QHG53222 | |
OrthoDB | 1 | 1.010 | - | - | D1552088at2759 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0004470 | |
OrthoInspector | 1 | 1.000 | - | - | otm40290 | |
orthoMCL | 1 | 0.900 | - | - | OOG6_104453 | |
Panther | 1 | 1.100 | - | - | O | PTHR46403 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R1722 |
SonicParanoid | 1 | 1.000 | - | - | X3757 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 1 | 0.960 | - | - | ||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
15 | 14.820 |