DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30108 and SPBC119.18

DIOPT Version :9

Sequence 1:NP_725705.2 Gene:CG30108 / 246460 FlyBaseID:FBgn0050108 Length:88 Species:Drosophila melanogaster
Sequence 2:NP_595295.1 Gene:SPBC119.18 / 2540098 PomBaseID:SPBC119.18 Length:69 Species:Schizosaccharomyces pombe


Alignment Length:72 Identity:30/72 - (41%)
Similarity:46/72 - (63%) Gaps:5/72 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SSVGEDCNELKQQYDACFNSWFSERFLKGQMDDSACAPIFRVYQECVKRAIKEKKIDLQEIDPIF 66
            |||.|:|...|::||||||.|::.:||||.:.:..|..:|..|:.|:.:|:|.||     |||:.
pombe     3 SSVSEECTPAKKKYDACFNDWYANKFLKGDLHNRDCDELFAEYKSCLLKALKTKK-----IDPLL 62

  Fly    67 ETGLEEN 73
            |...:|:
pombe    63 EAARKED 69

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30108NP_725705.2 UPF0203 2..58 CDD:283029 25/55 (45%)
SPBC119.18NP_595295.1 UPF0203 3..66 CDD:283029 29/67 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 69 1.000 Domainoid score I2680
eggNOG 1 0.900 - - E1_KOG3481
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 70 1.000 Inparanoid score I1929
OMA 1 1.010 - - QHG53222
OrthoFinder 1 1.000 - - FOG0004470
OrthoInspector 1 1.000 - - otm46976
orthoMCL 1 0.900 - - OOG6_104453
Panther 1 1.100 - - O PTHR46403
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1722
SonicParanoid 1 1.000 - - X3757
TreeFam 1 0.960 - -
1312.860

Return to query results.
Submit another query.