DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30105 and AT2G39440

DIOPT Version :10

Sequence 1:NP_725699.1 Gene:CG30105 / 246459 FlyBaseID:FBgn0050105 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_181476.2 Gene:AT2G39440 / 818529 AraportID:AT2G39440 Length:162 Species:Arabidopsis thaliana


Alignment Length:149 Identity:44/149 - (29%)
Similarity:66/149 - (44%) Gaps:12/149 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 TLDFNG---KNFAKGKNLDVHYLPAKIDGDGEANVKNYFNNYTREATEFGTGILTNALRGFPLMG 65
            |:||..   :|.....:..||.||..|..||...|.:||...:.:....|........||..|.|
plant     3 TIDFRAAADENSIVDLSSQVHQLPCCIRFDGPVEVSHYFKPKSSDVEIDGVKTEEAHFRGRKLQG 67

  Fly    66 EKLKVPEGYCGLVLQET--------EKPISDTSDRKL-RLTGVFQDFTYWNYDKVPSNGDPYRQA 121
            ..:.:|.||.|.||::.        .|....|.|.:. .:...|.:.||||:|.:||..|.:.::
plant    68 ATISLPSGYSGFVLRQASNLNANGKRKASMPTEDNQCWEVKAKFNNLTYWNHDSLPSKDDTFFRS 132

  Fly   122 LPLPDVAQALSQPISEEDL 140
            .....:|:||.:|:..|||
plant   133 FHWFSIAEALHKPVKVEDL 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30105NP_725699.1 RNase_H2-C 21..109 CDD:187752 28/96 (29%)
AT2G39440NP_181476.2 RNase_H2_suC 22..142 CDD:400782 34/119 (29%)

Return to query results.
Submit another query.