DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30098 and CG18754

DIOPT Version :9

Sequence 1:NP_725573.2 Gene:CG30098 / 246456 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster


Alignment Length:257 Identity:78/257 - (30%)
Similarity:107/257 - (41%) Gaps:49/257 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 LFRIRVIGGQNA--RRTPWMAYLIRDNRFACGGSLIAYRFVLTAAHCT-----KINDNLF--VRL 87
            :||.|  |.:||  ...|||..|:.:||.    |||  |:|||||||.     ..||.:.  |||
  Fly   103 VFRDR--GAENAELNEYPWMVLLLYENRL----SLI--RYVLTAAHCVIGGYLTQNDLVLKSVRL 159

  Fly    88 GEYDSSRTTDGQTRSYR-------VVSIYRHKNYID----FRNHDIAVLKLDRQVVYDAYIRPIC 141
            ||    .|||..|...|       |.....|:.:..    :|| |||:|:|...|.|...|:|||
  Fly   160 GE----STTDCITSESRCPHLDVEVGQTTVHQGFTSSGGTYRN-DIALLRLQFPVRYTKKIQPIC 219

  Fly   142 IL-LNSGLQSLANSIQNFTLTGWGQMAHYYKMPT-TLQEMSLRRVRNEYCGVPSLSICCWNPVQY 204
            :| ....||.|     |..::||........:.| |::|.:.....|.|....|.|..|....:.
  Fly   220 LLDAEFPLQDL-----NLQISGWDPTKSSQTLITSTVKERNPADCLNRYPSFRSASQVCAGGQRK 279

  Fly   205 --ACFGDSGGPLGSLVKYGHKTIYVQFGVTNSVTGNCDGYSS-----YLDLMSYMPWLYQTL 259
              .|.|.||.|:..::..|........|:.:.....|  ||:     |..:..:..|:...|
  Fly   280 GDTCAGISGSPVMGIMGSGVDEFVFLAGIASYGQQYC--YSAGIPGVYTKIGHFSEWIKANL 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 74/246 (30%)
Tryp_SPc 37..258 CDD:238113 74/249 (30%)
CG18754NP_652652.3 CLIP 35..84 CDD:288855
Tryp_SPc 108..338 CDD:238113 74/247 (30%)
Tryp_SPc 108..335 CDD:214473 73/244 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463654
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.