DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30098 and CG34409

DIOPT Version :9

Sequence 1:NP_725573.2 Gene:CG30098 / 246456 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001097728.2 Gene:CG34409 / 5740854 FlyBaseID:FBgn0085438 Length:511 Species:Drosophila melanogaster


Alignment Length:306 Identity:80/306 - (26%)
Similarity:120/306 - (39%) Gaps:63/306 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 TPAIVLLTFLVILTLGSYGYSQLLDSKCIALFRIRVIGGQ--NARRTPWMAYLIRDNR------F 58
            ||...:...|...|.....::|.....|......|::||.  :|.:.||:..:...||      |
  Fly   215 TPIETIPASLSTTTASMPPFAQENTQGCGINVESRLLGGDQASAGQFPWLTRIAYRNRSSSRISF 279

  Fly    59 ACGGSLIAYRFVLTAAHCTKIN-----DNLFVRLGEYDSSRTTDGQTRSYRVVSIYRHKNYID-- 116
            .|.||||:...::|||||. :|     :...||||      :.||.| .:.:..:..|.||..  
  Fly   280 RCSGSLISSNHIVTAAHCV-VNLVSDLELSHVRLG------SQDGAT-PFAIEQVIVHPNYDQPK 336

  Fly   117 FRNHDIAVLKLDRQVVYDAYIRPICILLNSGLQSLANSI--QNFTLTGW--GQMAHYYKMPTTLQ 177
            :.| |||:|:::..   :....|||:..| |..:|.|.:  |.....||  |...:...|..:..
  Fly   337 YAN-DIALLRINST---NGTFTPICLPFN-GPITLGNRLIGQIGVAAGWSIGSTENNSSMDPSNS 396

  Fly   178 EMSLRRVR-----NEYCGV--PSLS-------------ICCWN-PVQYACFGDSGGPL------G 215
            ...:|.:|     ...|.:  .|||             :|... |:...|.||||||.      |
  Fly   397 TAGVRFIRLPIVNTTSCAIAYASLSENFQQPIVITPNHLCAQGMPMNDVCRGDSGGPFMDDGTSG 461

  Fly   216 SLVKYGHKTI--YVQFGVTNSVTGNCDGYSSYLDLMSYMPWLYQTL 259
            .....|..||  .|.||.|........|.  |..:.|:..|:.:::
  Fly   462 VFGTSGRYTIIGIVAFGPTLCGVTTIPGV--YTLVSSFSDWILRSI 505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 73/265 (28%)
Tryp_SPc 37..258 CDD:238113 73/268 (27%)
CG34409NP_001097728.2 CLIP 26..71 CDD:288855
Tryp_SPc 249..501 CDD:214473 73/266 (27%)
Tryp_SPc 252..501 CDD:238113 72/263 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463659
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.