DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30098 and CG11843

DIOPT Version :9

Sequence 1:NP_725573.2 Gene:CG30098 / 246456 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001287578.1 Gene:CG11843 / 43432 FlyBaseID:FBgn0039630 Length:316 Species:Drosophila melanogaster


Alignment Length:261 Identity:83/261 - (31%)
Similarity:110/261 - (42%) Gaps:53/261 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 VIGGQNA--RRTPWMAYLIR----DNR--FACGGSLIAYRFVLTAAHCT-----KINDNLFVRLG 88
            ::||..|  |..|.||.|.|    .:|  :.|||.||:.|||||||||.     ::|   .||||
  Fly    68 IVGGHPAQPREFPHMARLGRRPDPSSRADWFCGGVLISERFVLTAAHCLESERGEVN---VVRLG 129

  Fly    89 EYD-SSRTTDGQTRSYRVVSIYRHKNYIDFR-NHDIAVLKLDRQVVYDAYIRPICILLNSGLQSL 151
            |.| .|...|...|.|.|.....|..|.|.: .|||.::||...||:|.|..|.|:....     
  Fly   130 ELDFDSLDEDAAPRDYMVAGYIAHPGYEDPQFYHDIGLVKLTEAVVFDLYKHPACLPFQD----- 189

  Fly   152 ANSIQNFTLTGWGQMAHYYKMPTTLQEMSLRRVRNEYC-------------GVPSLSICCWNP-- 201
            ..|..:|...|||......|....|.::.|:|..|..|             |....:..|...  
  Fly   190 ERSSDSFIAVGWGSTGLALKPSAQLLKVKLQRYGNWVCKKLLTRQVEEFPRGFDGNNQLCVGSEM 254

  Fly   202 VQYACFGDSGGPLGSLVKYGHKTIYVQFGVTNSVTGNCDGYSS--------YLDLMSYMPWLYQT 258
            .|..|.||||||| .:....:..:||..|:|::      |.|.        |..:..|:.|:.:|
  Fly   255 AQDTCNGDSGGPL-LMYHREYPCMYVVVGITSA------GLSCGSPGIPGIYTRVYPYLGWIART 312

  Fly   259 L 259
            |
  Fly   313 L 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 80/254 (31%)
Tryp_SPc 37..258 CDD:238113 81/258 (31%)
CG11843NP_001287578.1 Tryp_SPc 68..312 CDD:238113 81/258 (31%)
Tryp_SPc 68..309 CDD:214473 80/255 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437628
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.