DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30098 and CG11842

DIOPT Version :9

Sequence 1:NP_725573.2 Gene:CG30098 / 246456 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_651662.1 Gene:CG11842 / 43431 FlyBaseID:FBgn0039629 Length:319 Species:Drosophila melanogaster


Alignment Length:272 Identity:80/272 - (29%)
Similarity:118/272 - (43%) Gaps:54/272 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 KCIALFRIRVIGGQNA--RRTPWMAYLIRDN-----RFACGGSLIAYRFVLTAAHC-----TKIN 80
            ||.: :...:|||..|  :..|..|.|...:     .:.|||:||:.|.|||||||     ..:|
  Fly    65 KCTS-YAPLIIGGGPAVPKEFPHAARLGHKDENGEVEWFCGGTLISDRHVLTAAHCHYSPQGSVN 128

  Fly    81 DNLFVRLG--EYDSSRTTDGQTRSYRVVSIYRHK--NYIDFRNHDIAVLKLDRQVVYDAYIRPIC 141
               ..|||  |:|:: ..|.....:.|.....|.  :|....| ||:|::|.|.|.::.|..|.|
  Fly   129 ---IARLGDLEFDTN-NDDADPEDFDVKDFTAHPEFSYPAIYN-DISVVRLSRPVTFNDYKHPAC 188

  Fly   142 ILLNSGLQSLANSIQNFTLTGWGQMAHYYKMPTT----LQEMSLRRV---------RNE-----Y 188
            :..:.|  .|..|   |...||||:.   .:|.|    ||::.|...         ||:     |
  Fly   189 LPFDDG--RLGTS---FIAIGWGQLE---IVPRTENKKLQKVKLYNYGTRCRITADRNDELPEGY 245

  Fly   189 CGVPSLSICCWNPVQYACFGDSGGPLGSLVKYGHKTIYVQFGVTNSVTGNCDG---YSSYLDLMS 250
            .....|.|.. |..:..|.||||||: .:....:..:|...|:| |:...||.   .:.|..:..
  Fly   246 NATTQLCIGS-NEHKDTCNGDSGGPV-LIYHMDYPCMYHVMGIT-SIGVACDTPDLPAMYTRVHF 307

  Fly   251 YMPWLYQTLLRN 262
            |:.|:.|.|.:|
  Fly   308 YLDWIKQQLAKN 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 74/254 (29%)
Tryp_SPc 37..258 CDD:238113 75/257 (29%)
CG11842NP_651662.1 Tryp_SPc 73..315 CDD:238113 75/257 (29%)
Tryp_SPc 73..312 CDD:214473 74/254 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437626
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.