DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30098 and CG11841

DIOPT Version :9

Sequence 1:NP_725573.2 Gene:CG30098 / 246456 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster


Alignment Length:229 Identity:65/229 - (28%)
Similarity:107/229 - (46%) Gaps:47/229 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 RFACGGSLIAYRFVLTAAHC-----TKINDNLFVRLGEYD-SSRTTDGQTRSYRVVSIYRHKNYI 115
            ::.|||:||:.|.|||||||     .::|   .|||||.: .:.|.|.:...:.|:::..|..  
  Fly    99 KWFCGGTLISNRLVLTAAHCFFSEHGEVN---VVRLGELEFDTDTDDAEPEDFGVLALKAHPG-- 158

  Fly   116 DFRN----HDIAVLKLDRQVVYDAYIRPICILLNSGLQSLANSIQNFTLTGWGQMAHYYKMPTTL 176
             |.|    :||.:::|||:|.::.|..|.|:..:.|.|.     ::|...||||.....|....|
  Fly   159 -FENPQLYNDIGIVQLDREVKFNRYKHPACLPFDDGEQH-----ESFIAIGWGQKKFAQKESKKL 217

  Fly   177 QEMSLR--------------RVRNEYCGVPSLSICCWN-PVQYACFGDSGGPLGSLVKYGHKTI- 225
            .::.|:              .:.|.|  .|...:|..: ..:..|.||||||   ::.| ||.: 
  Fly   218 LKVQLQGYKDRCVSSVDANDELPNGY--EPKSQLCIGSRDNKDTCNGDSGGP---VLAY-HKDLA 276

  Fly   226 --YVQFGVTNS--VTGNCDGYSSYLDLMSYMPWL 255
              |...|:|::  .....|..|:|..:..::.|:
  Fly   277 CMYHVMGITSAGITCSTPDIPSAYTRVHYFLNWI 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 64/226 (28%)
Tryp_SPc 37..258 CDD:238113 65/229 (28%)
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 65/229 (28%)
Tryp_SPc 72..310 CDD:214473 64/227 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437627
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.