DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30098 and CG4815

DIOPT Version :9

Sequence 1:NP_725573.2 Gene:CG30098 / 246456 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_651607.1 Gene:CG4815 / 43360 FlyBaseID:FBgn0039568 Length:265 Species:Drosophila melanogaster


Alignment Length:230 Identity:55/230 - (23%)
Similarity:88/230 - (38%) Gaps:40/230 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 LIRDNRFACGGSLIAYRFVLTAAHC-TKINDNLFVRLGEYDSSRTTDGQT-RSYRVVSIYRHKNY 114
            |....:..|..:|:..|.:|||||| ..:|.:.|..:|...:..|..|.. ...:::.:..|..|
  Fly    53 LFNGRKLVCSATLLTPRHILTAAHCFENLNRSKFHVIGGKSAEFTWHGNNFNKNKLIRVQIHPKY 117

  Fly   115 IDFR-NHDIAVLKLDRQVVYDAYIRPICILLNSGLQSLANSI----QNFTLTGWGQMAHYY--KM 172
            ...: ..|:||.| .:..:...||         |...|..|:    ......|||.....:  ..
  Fly   118 AKMKFIADVAVAK-TKYPLRSKYI---------GYAQLCRSVLHPRDKLIAAGWGFEGGVWDESR 172

  Fly   173 PTTLQEMSLRRVRNEYC------GVPSLSIC--CWNPVQYACFGDSGGPLGSLVKYGHKTIYVQF 229
            ..|.:.|.:..|....|      .:|...||  .:|. :..|||||||||    ..|.:...:  
  Fly   173 KKTFRSMKVGIVSKRDCEKQLDRKMPPNIICAGAYNN-KTLCFGDSGGPL----LLGRQVCGI-- 230

  Fly   230 GVTNSVT---GNCDGYSSYLDLMSYMPWLYQTLLR 261
               |:.|   ||.:....|:.:..|..::.:|:.|
  Fly   231 ---NTWTFKCGNNEKPDVYMGVRYYAKFIKRTINR 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 53/221 (24%)
Tryp_SPc 37..258 CDD:238113 53/225 (24%)
CG4815NP_651607.1 Tryp_SPc 49..259 CDD:304450 53/225 (24%)
Trypsin 49..256 CDD:278516 53/222 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436645
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.