DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30098 and CG5909

DIOPT Version :9

Sequence 1:NP_725573.2 Gene:CG30098 / 246456 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_651544.1 Gene:CG5909 / 43274 FlyBaseID:FBgn0039495 Length:381 Species:Drosophila melanogaster


Alignment Length:277 Identity:96/277 - (34%)
Similarity:136/277 - (49%) Gaps:50/277 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 QLLDS--KCIALFRIRVIGGQNAR--RTPWMA---YLIRDNR-FACGGSLIAYRFVLTAAHCTKI 79
            |||:|  .|......:|.||:.||  ..||:|   |.|.|.| |.||||||:.|.:||||||  |
  Fly   114 QLLNSVTNCGNKGNPKVSGGKTARPGDFPWVALLKYKINDPRPFRCGGSLISERHILTAAHC--I 176

  Fly    80 NDN---LFVRLGEYDSSRTTD-----GQTR-------SYRVVSIYRHKNYIDFR-NHDIAVLKLD 128
            .|.   :.|||||:|.....|     |..|       .|.:..|..|.||:..: :||:|::|||
  Fly   177 IDQPEVIAVRLGEHDLESEEDCHYLGGTNRVCIPPYEEYGIEQIRVHPNYVHGKISHDVAIIKLD 241

  Fly   129 RQVVYDAYIRPICILLNSGLQSLANSIQNFTLTGWGQMAHYYKMPTTLQEMSLRRVRNEYC---- 189
            |.|...::|:|:|:.::...|.| :..|:|.:.|||. .....:.|.||:..:.|.....|    
  Fly   242 RVVKEKSHIKPVCLPIDQKSQEL-DFDQSFFVAGWGG-TEKETVATKLQQALITRKSLNECRQYY 304

  Fly   190 ---GVPSLSICCWNP-VQYACFGDSGGPLGSLVKYGHKTIY--VQFGVTNSVTGNCDG------Y 242
               .|....||.... :::.|.||||||:  ..|:..|..|  ||:||. |..|...|      :
  Fly   305 NKGEVSDNHICATGTGIKHTCQGDSGGPV--FFKHRFKNTYRVVQYGVV-SFGGRLCGQNQPGVF 366

  Fly   243 SSYLDLMSYMPWLYQTL 259
            :|.:|:   :||:.|.|
  Fly   367 ASVIDM---LPWITQNL 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 87/255 (34%)
Tryp_SPc 37..258 CDD:238113 89/258 (34%)
CG5909NP_651544.1 CLIP 25..82 CDD:197829
Tryp_SPc 129..376 CDD:214473 88/256 (34%)
Tryp_SPc 132..379 CDD:238113 88/256 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.